GDF-15 Protein, Mouse (HEK293, His-Flag)

GDF-15 Protein regulates food intake, energy balance, and body weight by binding to its receptor, GFRAL. This activates GFRAL-expressing neurons in the brainstem, triggering a 'emergency circuit' in the parabrachial nucleus and central amygdala during stress. GDF-15 also inhibits growth hormone signaling on hepatocytes and forms a disulfide-linked homodimer. Interacting with GFRAL, it acts as a ligand, facilitating GDF15 internalization and signaling through RET. GDF-15 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived GDF-15 protein, expressed by HEK293, with N-8*His, N-Flag labeled tag. The total length of GDF-15 Protein, Mouse (HEK293, His-Flag) is 115 a.a., with molecular weight of 14-16 kDa.

GDF-15 Protein plays a crucial role in regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. It accomplishes this by binding to its receptor, GFRAL, and activating GFRAL-expressing neurons located in the area postrema and nucleus tractus solitarius of the brainstem. This activation subsequently triggers the activation of neurons within the parabrachial nucleus and central amygdala, which are part of the 'emergency circuit' responsible for shaping feeding responses in stressful conditions. Additionally, GDF-15 Protein inhibits growth hormone signaling on hepatocytes and forms a homodimer that is disulfide-linked. It also interacts with GFRAL, acting as a ligand to facilitate GDF15 internalization and cellular signaling through its interaction with RET.

Mouse

HEK293

N-8*His;N-Flag

Q9Z0J7 (S189-A303)

23886  [NCBI]

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

14-16 KDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 4 mM HCl.

Less than 1 EU/µg as determined by LAL test.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.