HN1 Protein, Mouse (His)

HN1 protein negatively regulates AKT-mediated GSK3B signaling and induces the phosphorylation and degradation of CTNNB1 at “Ser-33”. This effect inhibits the “Ser-9” phosphorylation of GSK3B, inhibits the activity of APC:CTNNB1:GSK3B complex and blocks its interaction with CDH1. HN1 Protein, Mouse (His) is the recombinant mouse-derived HN1 protein, expressed by E. coli , with N-His labeled tag. The total length of HN1 Protein, Mouse (His) is 154 a.a., with molecular weight of ~18.3 kDa.

HN1 protein emerges as a key regulator in cellular processes, exerting a negative modulatory effect on AKT-mediated GSK3B signaling. It functions by inducing the phosphorylation and subsequent degradation of CTNNB1 at 'Ser-33.' This action is achieved through the suppression of the inhibitory 'Ser-9' phosphorylation of GSK3B, thereby dampening the activity of the APC:CTNNB1:GSK3B complex and impeding its interaction with CDH1/E-cadherin in adherent junctions. Beyond its role in cell adhesion, HN1 participates in the regulation of cell cycle dynamics, as evidenced by its impact on these fundamental cellular processes. Moreover, HN1 exhibits an inhibitory role in the AR-signaling pathway, contributing to the proteasomal degradation of the receptor. Notably, HN1 engages in interactions with the APC:CTNNB1:GSK3B complex, specifically with the inactive form of GSK3B phosphorylated at 'Ser-9,' highlighting its involvement in intricate cellular signaling networks.

Mouse

E. coli

N-His

P97825 (M1-G154)

15374  [NCBI]

MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPAEQPVRKNKMASNIFGTPEENPPSWAKSAGSKSSGGREDSESPGTQRSNSSEASSGDFLDLKGEGDMHENVDTDFQANLAQMEEKPVPAAPVPSPVAPAPVPSRRNPPGGKSSLVLG

Approximately 24 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.