1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-11
  5. IL-11 Protein, Cynomolgus

IL-11 Protein, Cynomolgus

Cat. No.: HY-P76415
COA Handling Instructions

IL-11 protein is a potent cytokine that significantly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, leading to megakaryocyte maturation and platelet production. It also promotes hepatocyte proliferation in response to liver injury. IL-11 Protein, Cynomolgus is the recombinant cynomolgus-derived IL-11 protein, expressed by E. coli , with tag free. The total length of IL-11 Protein, Cynomolgus is 178 a.a., with molecular weight of ~20 KDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $50 In-stock
10 μg $130 In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-11 protein is a potent cytokine that significantly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, leading to megakaryocyte maturation and platelet production. It also promotes hepatocyte proliferation in response to liver injury. IL-11 Protein, Cynomolgus is the recombinant cynomolgus-derived IL-11 protein, expressed by E. coli , with tag free. The total length of IL-11 Protein, Cynomolgus is 178 a.a., with molecular weight of ~20 KDa.

Background

IL-11 Protein is a potent cytokine that plays a crucial role in stimulating the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, leading to the maturation of megakaryocytes and subsequent production of platelets. Additionally, IL-11 Protein facilitates the proliferation of hepatocytes in response to liver damage. Upon binding to its receptor, composed of IL6ST and IL11RA, IL-11 Protein triggers a signaling cascade that promotes cell proliferation. This signaling cascade involves the activation of intracellular protein kinases and the phosphorylation of STAT3. IL-11 Protein can engage in two types of signaling: 'classic signaling' occurs through the interaction with membrane-bound IL11RA and IL6ST, while 'trans-signaling' is induced by the binding of IL-11 and soluble IL11RA to IL6ST. Furthermore, IL-11 Protein interacts with IL11RA to form a multimeric signaling complex in association with IL6ST.

Biological Activity

Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 4.216 ng/mL, corresponding to a specific activity is 2.371×105 units/mg.

Species

Cynomolgus

Source

E. coli

Tag

Tag Free

Accession

XP_005595839.2/P20808 (P22-L199)

Gene ID

102118349

Molecular Construction
N-term
IL-11 (P22-L199)
Accession # P20808
C-term
Synonyms
Interleukin-11; Il11; Adipogenesis Inhibitory Factor; AGIF
AA Sequence

PGPPPGSPRASPDPRAELDSTVLLTRSLLEDTRQLTIQLKDKFPADGDHNLDSLPTLAMSAGALGALQLPSVLTRLRADLLSYLRHVQWLRRAMGSSLKTLEPELGTLQTRLDRLLRRLQLLMSRLALPQLPPDPPAPPLAPPSSTWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Molecular Weight

Approximately 20 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-11 Protein, Cynomolgus Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-11 Protein, Cynomolgus
Cat. No.:
HY-P76415
Quantity:
MCE Japan Authorized Agent: