Leptin Protein, Carassius auratus (P.pastoris, His)

Leptin protein plays a pivotal role in regulating energy balance and body weight. It binds to its receptor, LEPR, in various tissues, activating signaling pathways that regulate energy homeostasis. Leptin Protein, Carassius auratus (P.pastoris, His) is the recombinant Leptin protein, expressed by P. pastoris , with N-8*His labeled tag. The total length of Leptin Protein, Carassius auratus (P.pastoris, His) is 150 a.a., with molecular weight of ~17.0 kDa.

Leptin protein assumes a pivotal role in the intricate regulation of energy balance and the control of body weight. Upon release into the circulation, leptin exerts both central and peripheral effects by binding to its receptor, LEPR, present in various tissues. This binding initiates the activation of several major signaling pathways, contributing to the multifaceted mechanisms involved in the regulation of energy homeostasis.

Others

P. pastoris

N-8*His

B8YI02 (P22-C171)

/

PVHPDRLKNMVKLQADTIILRIKDHNEKLKLYPKLLIGDPELYPEVPADRHIQGLGSIMDTLTIFQKVLQRLPKGHVSQIRSDLSTLLGYLKERTTSMHCILKEPANGRSLDAFLEENATHHITLGYLALDRLKQFMQKLIVNLDQLKSC

Approximately 17.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Citrate, 8% Trehalose, 4% Mannitol, 0.02% Tween80 (w/v), pH 5.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.