MBL2/COLEC1 Protein, Human (HEK293, His)

The MBL2/COLEC1 protein is a calcium-dependent lectin in innate immune defense that activates the lectin complement pathway by binding to mannose, fucose, and N-acetylglucosamine on microorganisms. MBL2/COLEC1 Protein, Human (HEK293, His) is the recombinant human-derived MBL2/COLEC1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of MBL2/COLEC1 Protein, Human (HEK293, His) is 228 a.a., with molecular weight of ~31.0 kDa.

MBL2, also known as COLEC1, is a calcium-dependent lectin actively involved in innate immune defense. This versatile protein binds to mannose, fucose, and N-acetylglucosamine on diverse microorganisms, initiating the lectin complement pathway. Furthermore, MBL2 exhibits a unique affinity for late apoptotic cells, apoptotic blebs, and necrotic cells, facilitating their efficient uptake by macrophages. Additionally, there is evidence suggesting its potential binding to DNA. In the context of SARS coronavirus-2 (SARS-CoV-2) infection, MBL2 plays a critical role in activating the complement lectin pathway, leading to the inhibition of SARS-CoV-2 infection and a reduction in the induced inflammatory response. Structurally, MBL2 forms oligomeric complexes composed of three or more homotrimers. Its functional interactions extend to MASP1, MASP2, MEP1A, MEP1B, and CR1, indicating its involvement in various regulatory and immune-related pathways.

Human

HEK293

C-6*His

P11226 (E21-I248)

4153  [NCBI]

ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI

Approximately 31.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 5% Threhalose, pH 7.2.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.