NECAP2 Protein, Human (His)

NECAP2 protein plays a pivotal role in endocytosis, interacting with adapter protein complexes AP-1 and AP-2, specifically with AP1G1 and AP2A1. Additionally, it connects with GAE domain proteins GGA1, GGA2, and GGA3, participating in a network of interactions that orchestrate endocytic events. NECAP2 emerges as a key regulator in cellular processes associated with membrane trafficking and vesicular transport. NECAP2 Protein, Human (His) is the recombinant human-derived NECAP2 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag. The total length of NECAP2 Protein, Human (His) is 263 a.a., with molecular weight of ~35.0 kDa.

NECAP2 protein assumes a pivotal role in the intricate process of endocytosis, where it interfaces with crucial components of adapter protein complexes AP-1 and AP-2, specifically interacting with AP1G1 and AP2A1. Furthermore, NECAP2 establishes connections with the GAE domain proteins GGA1, GGA2, and GGA3, revealing its involvement in a network of molecular interactions that contribute to the orchestration of endocytic events. Through these associations, NECAP2 emerges as a key player in regulating cellular processes associated with membrane trafficking and vesicular transport.

Human

E. coli

N-6*His;C-6*His

Q9NVZ3 (M1-F263)

55707  [NCBI]

MEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQF

Approximately 35.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.