Niemann Pick C2/NPC2 Protein, Rat (HEK293, His)

Niemann-Pick C2/NPC2 protein is an important member of the NPC2 family and plays an important role in lipid metabolism and transport, helping to regulate intracellular cholesterol homeostasis and lipid transport. Its involvement in cellular processes highlights its importance in maintaining lipid homeostasis. Niemann Pick C2/NPC2 Protein, Rat (HEK293, His) is the recombinant rat-derived Niemann Pick C2/NPC2 protein, expressed by HEK293 , with C-His labeled tag. The total length of Niemann Pick C2/NPC2 Protein, Rat (HEK293, His) is 130 a.a., with molecular weight of ~15.9 kDa.

The Niemann-Pick C2/NPC2 Protein is a crucial member of the NPC2 family, playing a significant role in lipid metabolism and transport. As part of this family, NPC2 contributes to the regulation of cholesterol homeostasis and lipid trafficking within cells. Its involvement in cellular processes highlights its importance in maintaining cellular lipid balance. The protein's membership in the NPC2 family suggests shared functional characteristics within this protein family, potentially influencing lipid-related pathways and cellular functions. The study of NPC2 provides insights into the broader understanding of lipid transport and metabolism, emphasizing its relevance in cellular homeostasis and potential implications for disorders related to lipid dysregulation.

Rat

HEK293

C-6*His

Q8CHN5 (E20-G149)

/

EPLHFKDCGSKVGVIKEVNVSPCPTQPCQLHKGQSYSVNVTFTSGTQSQNSTALVHGILAGVPVYFPIPEPDGCKCGINCPIQKDKVYSYLNKLPVKSEYPSLKLVVEWKLQDDKKDNLFCWEIPVEIKG

Approximately 19-22 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.