NINJ1 Protein, Mouse (Cell-Free, His)

The NINJ1 protein is an important mediator of programmed cell death, inducing plasma membrane rupture in necroptosis and pyroptosis. NINJ1 is activated by Gasdermin or MLKL, oligomerizes, releases DAMPs and exacerbates inflammation. NINJ1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived NINJ1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of NINJ1 Protein, Mouse (Cell-Free, His) is 152 a.a., with molecular weight of 18.1 kDa.

NINJ1 Protein serves as a pivotal effector in programmed cell death, mediating plasma membrane rupture in necroptosis and pyroptosis. Downstream of Gasdermin or MLKL activation, NINJ1 oligomerizes in response to death stimuli, introducing hydrophilic faces of two alpha helices into the hydrophobic membrane, leading to the release of damage-associated molecular patterns (DAMPs) and propagating the inflammatory response. Additionally, NINJ1 acts as a regulator of Toll-like receptor 4 (TLR4) signaling during systemic inflammation by directly binding lipopolysaccharide (LPS). It contributes to leukocyte migration, transendothelial migration of macrophages, and promotes monocyte migration to central nervous system inflammatory lesions. Functioning as a homophilic transmembrane adhesion molecule, NINJ1 is involved in axonal growth, cell chemotaxis, angiogenesis, and cell-to-cell interactions between immune cells and endothelial cells. It plays diverse roles in nerve regeneration, angiogenesis, vascular formation, osteoclast development, striated muscle growth, and differentiation. The secreted form exhibits chemotactic activity and acts as an anti-inflammatory mediator by promoting monocyte recruitment, thereby ameliorating atherosclerosis.

Mouse

E. coli Cell-free

N-10*His

O70131 (M1-Q152)

18081

MESGTEEYELNGDLRPGSPGSPDALPPRWGLRNRPINVNHYANKKSAAESMLDIALLMANASQLKAVVEQGNDFAFFVPLVVLISISLVLQIGVGVLLIFLVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITAFGVQKPVMDVAPRQ

18.1 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.