Protein E7, HPV (N-His, C-His)

Protein E7, HPV, crucially induces quiescent cells to enter the cell cycle, facilitating efficient utilization of cellular DNA replicating machinery for viral genome replication. With transforming and trans-activating activities, E7 disrupts the RB1-E2F1 complex, activating E2F1-regulated S-phase genes. It interferes with host histone deacetylation by HDAC1 and HDAC2, inhibiting antiviral functions of interferon alpha. E7's interaction with host TMEM173/STING hinders sensing cytosolic DNA, repressing type I interferon production. Forming homodimers and homooligomers, E7 associates with RB1, disrupting its activity, and with EP300 to repress transcriptional activity. Complex formation with CHD4 and HDAC1 alters host histone deacetylation, while the interaction with protein E2 inhibits E7 oncogenic activity. E7's multifaceted actions underscore its pivotal role in HPV-associated cellular processes and intricate modulation of host cell functions. Protein E7, HPV (N-His, C-His) is the recombinant Virus-derived protein E7, HPV, expressed by E. coli, with N-6*His, C-6*His labeled tag. The total length of Protein E7, HPV (N-His, C-His) is 98 a.a., with molecular weight of 16.3 kDa.

The Protein E7 from Human Papillomavirus (HPV) plays a crucial role in viral genome replication by inducing quiescent cells to enter the cell cycle, facilitating the efficient utilization of the cellular DNA replicating machinery for viral genome replication. E7 exhibits both transforming and trans-activating activities, disrupting the RB1-E2F1 complex and activating E2F1-regulated S-phase genes. It interferes with host histone deacetylation mediated by HDAC1 and HDAC2, resulting in transcriptional activation. Additionally, E7 inhibits the antiviral and antiproliferative functions of host interferon alpha. Its interaction with host TMEM173/STING hinders the ability of TMEM173/STING to sense cytosolic DNA and promote type I interferon production. E7 forms homodimers and homooligomers, interacts with host RB1 to disrupt RB1 activity, and associates with EP300 to repress EP300 transcriptional activity. Complex formation with CHD4 and HDAC1 alters host histone deacetylation, while the interaction with protein E2 inhibits E7 oncogenic activity. The multifaceted actions of Protein E7 underscore its pivotal role in HPV-associated cellular processes and its intricate modulation of host cell functions.

Virus

E. coli

N-6*His;C-6*His

P03129 (M1-P98)

1489079  [NCBI]

MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

16.3 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.