SPARC Protein, Mouse (HEK293, His)

SPARC proteins are components of chylomicrons, LDL, and VLDL and promote cellular binding and internalization of LDL particles. Interactions with various proteins, including PCSK9 and MTTP, contribute to its function. SPARC Protein, Mouse (HEK293, His) is the recombinant mouse-derived SPARC protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SPARC Protein, Mouse (HEK293, His) is 285 a.a., with molecular weight of ~37 kDa.

Apolipoprotein B-100 (ApoB) is a predominant protein component found in chylomicrons (apo B-48), LDL (apo B-100), and VLDL (apo B-100). Apo B-100 serves as a recognition signal for the cellular binding and internalization of LDL particles through the apoB/E receptor. Its interactions with various proteins contribute to its functional roles, such as binding with PCSK9 and MTTP. Additionally, ApoB interacts with AUP1 and plays a crucial role in the early secretory pathway's COPI vesicle-mediated retrograde transport, facilitating coatomer recruitment to membranes. It enhances the coatomer-dependent activity of ARFGAP2 and contributes to the specific retention of p24 complexes in cis-Golgi membranes. ApoB is implicated in organizing intracellular membranes, including the ER-Golgi intermediate compartment and the Golgi apparatus. Furthermore, it plays a role in the ER localization of PTPN2 isoform PTPB and is involved in interactions with other members of the EMP24/GP25L family, such as TMED2, TMED7, and TMED10. These interactions, along with associations with COPG1, PTPN2, SPAST, and STX17, contribute to ApoB's multifaceted involvement in vesicular protein trafficking and membrane organization within the cell.

Mouse

HEK293

C-6*His

P07214 (A18-I302)

20692  [NCBI]

APQQTEVAEEIVEEETVVEETGVPVGANPVQVEMGEFEDGAEETVEEVVADNPCQNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALEEWAGCFGIKEQDINKDLVI

Approximately 37 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.