TLCD1 Protein, Human (Cell-Free, His)

TLCD1 Protein intricately regulates plasma membrane dynamics by inhibiting the integration of omega-3 LCPUFA-enriched phospholipids, fostering membrane rigidity. Remarkably, TLCD1's influence is specific to membrane properties, showing no discernible impact on LCPUFA synthesis. This nuanced regulation establishes TLCD1 as a key player in preserving the structural integrity and functional balance of the plasma membrane. TLCD1 Protein, Human (Cell-Free, His) is the recombinant human-derived TLCD1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of TLCD1 Protein, Human (Cell-Free, His) is 212 a.a., with molecular weight of 26.1 kDa.

TLCD1 protein serves as a crucial regulator of plasma membrane dynamics by intricately modulating its composition and fluidity. Notably, TLCD1 exerts inhibitory control over the integration of membrane-fluidizing phospholipids enriched with omega-3 long-chain polyunsaturated fatty acids (LCPUFA), thereby fostering membrane rigidity. Interestingly, TLCD1's influence seems specific to membrane properties, as it does not manifest any discernible impact on the synthesis of LCPUFAs. This nuanced regulation positions TLCD1 as a key player in maintaining the structural integrity and functional balance of the plasma membrane.

Human

E. coli Cell-free

N-10*His

Q96CP7 (R36-E247)

116238

RADPLRTWRWHNLLVSFAHSIVSGIWALLCVWQTPDMLVEIETAWSLSGYLLVCFSAGYFIHDTVDIVASGQTRASWEYLVHHVMAMGAFFSGIFWSSFVGGGVLTLLVEVSNIFLTIRMMMKISNAQDHLLYRVNKYVNLVMYFLFRLAPQAYLTHFFLRYVNQRTLGTFLLGILLMLDVMIIIYFSRLLRSDFCPEHVPKKQHKDKFLTE

26.1 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.