ULBP1 Protein, Human (Biotinylated, HEK293, mFc-Avi)

ULBP1/RAET1I Protein is crucial in natural killer cell cytotoxicity, binding to and activating the KLRK1/NKG2D receptor. This mechanism underscores ULBP1/RAET1I's significance in mediating cytotoxic responses. Notably, ULBP1/RAET1I does not bind beta2-microglobulin, emphasizing its specificity and selectivity in engaging KLRK1/NKG2D. This distinct interaction profile highlights ULBP1/RAET1I's pivotal role in immune responses and its potential as a therapeutic target for modulating natural killer cell activity. ULBP1 Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived ULBP1 protein, expressed by HEK293, with C-Avi, C-mFc labeled tag. The total length of ULBP1 Protein, Human (Biotinylated, HEK293, mFc-Avi) is 191 a.a., with molecular weight of 51.3 kDa.

The ULBP1/RAET1I protein plays a crucial role in natural killer cell cytotoxicity by acting as a ligand that binds to and activates the KLRK1/NKG2D receptor. This binding and activation mechanism highlights the significance of ULBP1/RAET1I in mediating the cytotoxic responses of natural killer cells. Moreover, it is noteworthy that ULBP1/RAET1I does not exhibit binding to beta2-microglobulin. This characteristic interaction profile underscores the specificity and selectivity of ULBP1/RAET1I in its engagement with KLRK1/NKG2D, emphasizing its pivotal role in immune responses and its potential as a therapeutic target for modulating natural killer cell activity.

Human

HEK293

C-Avi;C-mFc

Q9BZM6 (G26-G216)

80329  [NCBI]

GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG

51.3 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.