AIMP2 Protein, Human (His)

AIMP2 Protein, Human (His) plays a primary role in the initiation of α-synuclein (aSyn) aggregation.

Aminoacyl-tRNA synthetase complex interacting multifunctional protein-2 (AIMP2), which has been reported to cause selective and age-dependent degeneration of dopaminergic neurons, plays an essential role in the initiation of aSyn fibrillization and LB formation. AIMP2 first self-assembles to form amyloid-like aggregates, which interact with monomeric aSyn and induce its fibrillization in vitro as well as the formation of aSyn fibrils and LB-like inclusions in various well-established cellular and animal models of synucleinopathies. AIMP2 is part of the multiaminoacyl-tRNA synthetase complex, where it acts as a scaffold subunit to stabilize the whole complex. This complex plays a pivotal role in protein biosynthesis by catalyzing the esterification of amino acids with their corresponding tRNA. In this regard, its function suggests that it possess multiple protein-protein interaction surfaces^[1].

Human

E. coli

N-His

Q13155 (1M-320K)

7965  [NCBI]

MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK

Approximately 39.3 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Hilal A Lashuel, et al. Lewy body-associated proteins: victims, instigators, or innocent bystanders? The case of AIMP2 and alpha-synuclein. Neurobiol Dis. 2021 Aug;156:105417.  [Content Brief]