1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Anionic trypsin protein, Dog (His-SUMO)

Anionic trypsin protein, Dog (His-SUMO)

Cat. No.: HY-P71480
Handling Instructions

Anionic trypsin (serine protease 2, PRSS2) is a member of trypsin family of serine proteases which is found at high levels in pancreatic juice and its upregulation is a characteristic feature of pancreatitis. PRSS2 has also been found to activate pro-urokinase in ovarian tumors, suggesting a function in tumor invasion. PRSS2 potentially participating in the degradation of type II collagen-rich cartilage matrix. Anionic trypsin protein, Dog (His-SUMO) is the recombinant dog-derived Anionic trypsin protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Anionic trypsin (serine protease 2, PRSS2) is a member of trypsin family of serine proteases which is found at high levels in pancreatic juice and its upregulation is a characteristic feature of pancreatitis. PRSS2 has also been found to activate pro-urokinase in ovarian tumors, suggesting a function in tumor invasion. PRSS2 potentially participating in the degradation of type II collagen-rich cartilage matrix. Anionic trypsin protein, Dog (His-SUMO) is the recombinant dog-derived Anionic trypsin protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

Anionic trypsin (serine protease 2, PRSS2) is a member of trypsin family of serine proteases which cleave peptide bonds that follow lysine or arginine residues. PRSS2 is part of a cluster of trypsinogen genes that are located within the T cell receptor beta locus. PRSS2 is found at high levels in pancreatic juice and its upregulation is a characteristic feature of pancreatitis. PRSS2 has also been found to activate pro-urokinase in ovarian tumors, suggesting a function in tumor invasion. In addition, PRSS2 is able to cleave across the type II collagen triple helix in rheumatoid arthritis synovitis tissue, potentially participating in the degradation of type II collagen-rich cartilage matrix[1][2][3].

Species

Dog

Source

E. coli

Tag

N-His;N-SUMO

Accession

P06872 (I24-S247)

Gene ID

100686744  [NCBI]

Molecular Construction
N-term
6*His-SUMO
TRY2 (I24-S247)
Accession # P06872
C-term
Synonyms
; Anionic trypsin; EC 3.4.21.4
AA Sequence

IVGGYTCEENSVPYQVSLNAGYHFCGGSLISDQWVVSAAHCYKSRIQVRLGEYNIDVLEGNEQFINSAKVIRHPNYNSWILDNDIMLIKLSSPAVLNARVATISLPRACAAPGTQCLISGWGNTLSSGTNYPELLQCLDAPILTQAQCEASYPGQITENMICAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKNKPGVYTKVCNFVDWIQSTIAANS

Molecular Weight

Approximately 40.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Anionic trypsin protein, Dog (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Anionic trypsin protein, Dog (His-SUMO)
Cat. No.:
HY-P71480
Quantity:
MCE Japan Authorized Agent: