1. Recombinant Proteins
  2. Others
  3. ANP32A Protein, Human (His)

ANP32A Protein, Human (His)

Cat. No.: HY-P76150
Handling Instructions

The multifunctional ANP32A protein regulates multiple cellular processes, including tumor suppression, apoptosis, cell cycle progression, and transcription. It promotes apoptosis by activating caspase-9 and supporting apoptotic body formation. ANP32A Protein, Human (His-GST) is the recombinant human-derived ANP32A protein, expressed by E. coli , with N-His, N-GST labeled tag. The total length of ANP32A Protein, Human (His) is 237 a.a., with molecular weight of ~28 KDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The multifunctional ANP32A protein regulates multiple cellular processes, including tumor suppression, apoptosis, cell cycle progression, and transcription. It promotes apoptosis by activating caspase-9 and supporting apoptotic body formation. ANP32A Protein, Human (His-GST) is the recombinant human-derived ANP32A protein, expressed by E. coli , with N-His, N-GST labeled tag. The total length of ANP32A Protein, Human (His) is 237 a.a., with molecular weight of ~28 KDa.

Background

The ANP32A protein emerges as a multifunctional regulator involved in diverse cellular processes, encompassing tumor suppression, apoptosis, cell cycle progression, and transcription. Functionally versatile, it promotes apoptosis by facilitating the activation of caspase-9 (CASP9) and supporting apoptosome formation. Additionally, ANP32A contributes to the modulation of histone acetylation and transcription as part of the INHAT (inhibitor of histone acetyltransferases) complex. It exerts inhibitory control over EP300/CREBBP and EP300/CREBBP-associated factor by histone masking, preferentially binding to unmodified histone H3 and impeding its acetylation and phosphorylation, leading to cell growth inhibition. Beyond chromatin dynamics, ANP32A participates in various biochemical processes, including the regulation of mRNA nuclear-to-cytoplasmic translocation and stability through its association with ELAVL1 (Hu-antigen R). The protein also plays a role in E4F1-mediated transcriptional repression and inhibits protein phosphatase 2A. Notably, ANP32A is indispensable for influenza A, B, and C viral genome replication, mediating the assembly of viral replicase asymmetric dimers and playing a crucial role in foamy virus mRNA export from the nucleus. This versatile functionality underscores the integral role of ANP32A in orchestrating multiple cellular pathways.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P39687 (E2-K238)

Gene ID
Molecular Construction
N-term
His-GST
ANP32A (E2-K238)
Accession # P39687
C-term
Synonyms
Acidic leucine-rich nuclear phosphoprotein 32 family member A; pp32; LANP; Mapmodulin; C15orf1; MAPM; PHAP1
AA Sequence

EMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRK

Molecular Weight

Approximately 28 kDa.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ANP32A Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ANP32A Protein, Human (His)
Cat. No.:
HY-P76150
Quantity:
MCE Japan Authorized Agent: