1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. APEG1 Protein, Human (His)

APEG1 Protein, Human (His)

Cat. No.: HY-P76729
COA Handling Instructions

APEG1 Isoform 3 potentially regulates the growth and differentiation of arterial smooth muscle cells. APEG1 Protein, Human (His) is the recombinant human-derived APEG1 protein, expressed by E. coli , with C-His labeled tag. The total length of APEG1 Protein, Human (His) is 113 a.a., with molecular weight of ~15 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $40 In-stock
10 μg $68 In-stock
50 μg $190 In-stock
100 μg $325 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

APEG1 Isoform 3 potentially regulates the growth and differentiation of arterial smooth muscle cells. APEG1 Protein, Human (His) is the recombinant human-derived APEG1 protein, expressed by E. coli , with C-His labeled tag. The total length of APEG1 Protein, Human (His) is 113 a.a., with molecular weight of ~15 kDa.

Background

APEG1, specifically isoform 3, is implicated in the potential regulation of growth and differentiation processes in arterial smooth muscle cells.

Biological Activity

When Recombinant Human APEG1 Protein is immobilized at 10 µg/mL (100 µL/well) can bind Anti- APEG1 Antibody, The ED50 for this effect is 8.941 μg/mL.

  • When Recombinant Human APEG1 Protein is immobilized at 10 µg/mL (100 µL/well) can bind Anti- APEG1 Antibody, The ED50 for this effect is 8.941 μg/mL.
Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q15772-4 (M1-E113)

Gene ID
Molecular Construction
N-term
APEG1 (M1-E113)
Accession # Q15772-4
His
C-term
Synonyms
Striated muscle preferentially expressed protein kinase; APEG-1; SPEG; KIAA1297
AA Sequence

MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE

Molecular Weight

Approximately 15 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

APEG1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
APEG1 Protein, Human (His)
Cat. No.:
HY-P76729
Quantity:
MCE Japan Authorized Agent: