1. Recombinant Proteins
  2. Others
  3. BAMBI/NMA Protein, Mouse (HEK293, His)

BAMBI/NMA Protein, Mouse (HEK293, His)

Cat. No.: HY-P74390
COA Handling Instructions

BAMBI/NMA Protein acts as a negative regulator, controlling TGF-beta signaling and modulating cellular responses within the intricate network. Its regulatory role ensures a balanced and controlled signaling cascade, making BAMBI/NMA a key player in fine-tuning cellular outcomes influenced by TGF-beta. This highlights its significance in maintaining the delicate balance of signaling pathways involved in various physiological processes. BAMBI/NMA Protein, Mouse (HEK293, His) is the recombinant mouse-derived BAMBI/NMA protein, expressed by HEK293 , with C-His labeled tag. The total length of BAMBI/NMA Protein, Mouse (HEK293, His) is 152 a.a., with molecular weight of 19-24 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $60 In-stock
10 μg $105 In-stock
50 μg $290 In-stock
100 μg $495 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

BAMBI/NMA Protein, Mouse (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BAMBI/NMA Protein acts as a negative regulator, controlling TGF-beta signaling and modulating cellular responses within the intricate network. Its regulatory role ensures a balanced and controlled signaling cascade, making BAMBI/NMA a key player in fine-tuning cellular outcomes influenced by TGF-beta. This highlights its significance in maintaining the delicate balance of signaling pathways involved in various physiological processes. BAMBI/NMA Protein, Mouse (HEK293, His) is the recombinant mouse-derived BAMBI/NMA protein, expressed by HEK293 , with C-His labeled tag. The total length of BAMBI/NMA Protein, Mouse (HEK293, His) is 152 a.a., with molecular weight of 19-24 kDa.

Background

BAMBI/NMA protein serves as a negative regulator of TGF-beta signaling, exerting control over the intricate pathways associated with this crucial cellular communication network. Through its regulatory role, BAMBI/NMA contributes to the modulation of TGF-beta-mediated cellular responses, ensuring a balanced and controlled signaling cascade. This negative regulatory function positions BAMBI/NMA as a key player in fine-tuning the cellular outcomes influenced by TGF-beta, highlighting its significance in maintaining the delicate balance of signaling pathways involved in various physiological processes.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q9D0L6 (E27-A152)

Gene ID

68010  [NCBI]

Molecular Construction
N-term
BAMBI (M1-A152)
Accession # Q9D0L6
His
C-term
Synonyms
BMP and activin membrane-bound inhibitor homolog; BAMBI; NMA
AA Sequence

EIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNTNSPLTHGCLDSLASTADICRAKQAQNHSGPAMPTLECCHEDMCNYRGLHDVLSPSKSEASGQGNRYQHDSSRNLITKMQELTSSKELWFRA

Molecular Weight

Approximately 19-24 kDa due to the glycosylation

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

BAMBI/NMA Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BAMBI/NMA Protein, Mouse (HEK293, His)
Cat. No.:
HY-P74390
Quantity:
MCE Japan Authorized Agent: