1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. BPHL Protein, Human (His)

BPHL Protein, Human (His)

Cat. No.: HY-P76177
COA Handling Instructions

The BPHL protein is a serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs, such as nucleoside analogs such as valacyclovir and valganciclovir. It converts valacyclovir to acyclovir via hydrolysis. BPHL Protein, Human (His) is the recombinant human-derived BPHL protein, expressed by E. coli , with N-His labeled tag. The total length of BPHL Protein, Human (His) is 254 a.a., with molecular weight of ~30 KDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $45 In-stock
10 μg $70 In-stock
50 μg $185 In-stock
100 μg $295 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The BPHL protein is a serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs, such as nucleoside analogs such as valacyclovir and valganciclovir. It converts valacyclovir to acyclovir via hydrolysis. BPHL Protein, Human (His) is the recombinant human-derived BPHL protein, expressed by E. coli , with N-His labeled tag. The total length of BPHL Protein, Human (His) is 254 a.a., with molecular weight of ~30 KDa.

Background

BPHL protein, a serine hydrolase, serves as a catalyst for the hydrolytic activation of amino acid ester prodrugs, exemplified by nucleoside analogs like valacyclovir and valganciclovir. Notably, it facilitates the conversion of valacyclovir to acyclovir through hydrolysis. Beyond its role in drug activation, BPHL is implicated in potential detoxification processes. As a specific alpha-amino acid ester hydrolase, it displays a preference for small, hydrophobic, and aromatic side chains, without imposing strict requirements on the leaving group, except for a preference toward a primary alcohol. Existing as a monomer, BPHL may also engage in the formation of homodimers.

Biological Activity

Defined as the amount of valacyclovir that 1μg of BPHL can hydrolysis at 37°C for 1 minute. The specific activity is 25.264 pmol/min/μg.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q86WA6-1 (S38-Q291)

Gene ID

670  [NCBI]

Molecular Construction
N-term
His
BPHL (S38-Q291)
Accession # Q86WA6
C-term
Synonyms
Biphenyl hydrolase like; Bph-rp; VACVase; Valacyclovirase; MCNAA
AA Sequence

SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ

Molecular Weight

Approximately 30 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

BPHL Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BPHL Protein, Human (His)
Cat. No.:
HY-P76177
Quantity:
MCE Japan Authorized Agent: