1. Recombinant Proteins
  2. Others
  3. Brorin/VWC2 Protein, Human (HEK293, His)

Brorin/VWC2 Protein, Human (HEK293, His)

Cat. No.: HY-P77506
COA Handling Instructions

The Brorin/VWC2 protein is a bone morphogenetic protein antagonist that promotes cell adhesion and associates peripherally with the AMPAR complex, a key player in synaptic transmission. In the AMPAR complex, Brorin/VWC2 and various proteins (such as CNIH2, CNIH3, CACNG2, etc.) together form a complex structure. Brorin/VWC2 Protein, Human (HEK293, His) is the recombinant human-derived Brorin/VWC2 protein, expressed by HEK293 , with C-His labeled tag. The total length of Brorin/VWC2 Protein, Human (HEK293, His) is 325 a.a., with molecular weight of ~44 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $35 In-stock
10 μg $60 In-stock
50 μg $170 In-stock
100 μg $290 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Brorin/VWC2 protein is a bone morphogenetic protein antagonist that promotes cell adhesion and associates peripherally with the AMPAR complex, a key player in synaptic transmission. In the AMPAR complex, Brorin/VWC2 and various proteins (such as CNIH2, CNIH3, CACNG2, etc.) together form a complex structure. Brorin/VWC2 Protein, Human (HEK293, His) is the recombinant human-derived Brorin/VWC2 protein, expressed by HEK293 , with C-His labeled tag. The total length of Brorin/VWC2 Protein, Human (HEK293, His) is 325 a.a., with molecular weight of ~44 kDa.

Background

Brorin/VWC2 Protein, a bone morphogenetic protein (BMP) antagonist, is implicated in neural development and functions as a promoter of cell adhesion. It is peripherally associated with the α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor (AMPAR) complex, a critical player in synaptic transmission. The AMPAR complex consists of an inner core comprising pore-forming GluA/GRIA proteins and major auxiliary subunits arranged in a twofold symmetry. Brorin/VWC2, serving as one of the peripherally associated constituents, contributes to the intricate architecture of the AMPAR complex. This complex includes various proteins like CNIH2, CNIH3, CACNG2, CACNG3, CACNG4, CACNG8, GSG1L, PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L, and NRN1, among others. Together, these proteins form a platform that regulates the gating, pharmacology, biogenesis, and protein processing of the AMPAR complex, thereby influencing synaptic function and plasticity.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q2TAL6 (S28-M325)

Gene ID
Molecular Construction
N-term
Brorin (M1-M325)
Accession # Q2TAL6
His
C-term
Synonyms
Brorin; Brain-specific chordin-like protein; UNQ739/PRO1434
AA Sequence

SPSIPLEKLAQAPEQPGQEKREHASRDGPGRVNELGRPARDEGGSGRDWKSKSGRGLAGREPWSKLKQAWVSQGGGAKAGDLQVRPRGDTPQAEALAAAAQDAIGPELAPTPEPPEEYVYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLCTEEGPLCAQPECPRLHPRCIHVDTSQCCPQCKERKNYCEFRGKTYQTLEEFVVSPCERCRCEANGEVLCTVSACPQTECVDPVYEPDQCCPICKNGPNCFAETAVIPAGREVKTDECTICHCTYEEGTWRIERQAMCTRHECRQM

Molecular Weight

Approximately 44 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Brorin/VWC2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Brorin/VWC2 Protein, Human (HEK293, His)
Cat. No.:
HY-P77506
Quantity:
MCE Japan Authorized Agent: