1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Cathepsin
  4. Cathepsin K
  5. Cathepsin K Protein, Mouse (His)

Cathepsin K Protein, Mouse (His)

Cat. No.: HY-P72157
COA Handling Instructions

Cathepsin K protein is a thiol protease that is critical in osteoclastic bone resorption and exhibits potent endoprotease activity against fibrinogen under acidic conditions. Its potential role in extracellular matrix degradation is noteworthy. Cathepsin K Protein, Mouse (His) is the recombinant mouse-derived Cathepsin K protein, expressed by E. coli , with N-6*His labeled tag. The total length of Cathepsin K Protein, Mouse (His) is 215 a.a., with molecular weight of ~31 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $110 In-stock
10 μg $187 In-stock
20 μg $318 In-stock
50 μg $575 In-stock
100 μg $890 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Cathepsin K Protein, Mouse (His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cathepsin K protein is a thiol protease that is critical in osteoclastic bone resorption and exhibits potent endoprotease activity against fibrinogen under acidic conditions. Its potential role in extracellular matrix degradation is noteworthy. Cathepsin K Protein, Mouse (His) is the recombinant mouse-derived Cathepsin K protein, expressed by E. coli , with N-6*His labeled tag. The total length of Cathepsin K Protein, Mouse (His) is 215 a.a., with molecular weight of ~31 kDa.

Background

Cathepsin K Protein, a thiol protease, is integral to osteoclastic bone resorption and exhibits potent endoprotease activity against fibrinogen under acidic conditions. Additionally, it may play a significant role in extracellular matrix degradation (By similarity). Notably, Cathepsin K is involved in the release of thyroid hormone thyroxine (T4) through limited proteolysis of TG/thyroglobulin in the thyroid follicle lumen, as demonstrated by studies. This dual functionality underscores its importance in bone metabolism and extracellular matrix dynamics, as well as its specific involvement in the regulated release of thyroid hormones.

Biological Activity

Measured by its ability to cleave the fluorogenic peptide substrate, Z-Gly-Pro-Arg-MCA.The specific activity is 1949.534 pmol/min/µg, as measured under the described conditions.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P55097 (V115-M329)

Gene ID
Molecular Construction
N-term
6*His
Cathepsin K (V115-M329)
Accession # P55097
C-term
Synonyms
Ctsk; Cathepsin K; EC 3.4.22.38
AA Sequence

VPDSIDYRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVTENYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVARVGPISVSIDASLASFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGSKHWIIKNSWGESWGNKGYALLARNKNNACGITNMASFPKM

Molecular Weight

Approximately 31 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Cathepsin K Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cathepsin K Protein, Mouse (His)
Cat. No.:
HY-P72157
Quantity:
MCE Japan Authorized Agent: