1. Recombinant Proteins
  2. CD Antigens
  3. Stem Cell CD Proteins Epithelial cell CD Proteins Cell Adhesion-related CD Proteins
  4. MUC-24/CD164
  5. CD164 Protein, Cynomolgus (HEK293, Fc)

CD164 Protein, Cynomolgus (HEK293, Fc)

Cat. No.: HY-P77315
COA Handling Instructions

CD164 Protein, a sialomucin, potentially plays a pivotal role in hematopoiesis, facilitating CD34+ cell adhesion while negatively regulating CD34+ cell proliferation. CD164 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived CD164 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD164 Protein, Cynomolgus (HEK293, Fc) is 163 a.a., with molecular weight of 75-110 KDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $48 In-stock
10 μg $75 In-stock
50 μg $215 In-stock
100 μg $340 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD164 Protein, a sialomucin, potentially plays a pivotal role in hematopoiesis, facilitating CD34+ cell adhesion while negatively regulating CD34+ cell proliferation[1]. CD164 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived CD164 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD164 Protein, Cynomolgus (HEK293, Fc) is 163 a.a., with molecular weight of 75-110 KDa.

Background

CD164 Protein belongs to the mucin or sialomucin family of glycoproteins. It modulates umbilical cord blood CD133+ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow infiltration. CD164 enhances CXCR4-dependent cell motility, myoblast migration, and myoblast fusion into myotubes, exerting positive influences on myogenesis. The protein, existing as a homodimer (isoform 4), interacts with CXCR4 in these processes. Human CD164 is a type 1 integral transmembrane molecule containing in its extracellular region two highly 0-glycosylated domains linked by a cysteine-rich non-mucin subdomain[1].

Biological Activity

When Recombinant Cynomolgus CD164 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Anti-CD164 antibody. The ED50 for this effect is 3.053 μg/mL.

  • When Recombinant Cynomolgus CD164 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Anti-CD164 antibody. The ED50 for this effect is 3.053 μg/mL.
Species

Cynomolgus

Source

HEK293

Tag

C-hFc

Accession

XP_005551610 (N26-D163)

Gene ID

102136974  [NCBI]

Molecular Construction
N-term
CD164 (M1-D163)
Accession # XP_005551610
hFc
C-term
Synonyms
Sialomucin core protein 24; MUC-24; Endolyn; MGC-24; CD164
AA Sequence

NPTPHTNVTSLAPTSNITSAPVTSLPLVTTPAPETCEGRNSCVSCFNASTVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVVPTATLVPTANSTAKPTVQPSPSTTSKTVTTSGTTNTTVTPTSQPVRKSTFD

Molecular Weight

Approximately 75-110 kDa to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD164 Protein, Cynomolgus (HEK293, Fc)
Cat. No.:
HY-P77315
Quantity:
MCE Japan Authorized Agent: