1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins
  4. CD300a
  5. CD300a/LMIR1 Protein, Human (HEK293, Fc-His)

CD300a/LMIR1 Protein, Human (HEK293, Fc-His)

Cat. No.: HY-P70754
Handling Instructions

CD300a/LMIR1 Protein, an inhibitory receptor, potentially diminishes cytolytic activity in NK cells and suppresses mast cell degranulation. It serves as a negative regulator in MYD88-mediated TLR signaling, activating PTPN6 but not TRIF. Upon tyrosine phosphorylation, CD300a/LMIR1 engages with PTN6/SHP-1, PTPN11/SHP-2, and INPP5D, showcasing its multifaceted involvement in immune regulation and cellular responses. CD300a/LMIR1 Protein, Human (HEK293, Fc-His) is the recombinant human-derived CD300a/LMIR1 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag. The total length of CD300a/LMIR1 Protein, Human (HEK293, Fc-His) is 161 a.a., with molecular weight of ~75.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD300a/LMIR1 Protein, an inhibitory receptor, potentially diminishes cytolytic activity in NK cells and suppresses mast cell degranulation. It serves as a negative regulator in MYD88-mediated TLR signaling, activating PTPN6 but not TRIF. Upon tyrosine phosphorylation, CD300a/LMIR1 engages with PTN6/SHP-1, PTPN11/SHP-2, and INPP5D, showcasing its multifaceted involvement in immune regulation and cellular responses. CD300a/LMIR1 Protein, Human (HEK293, Fc-His) is the recombinant human-derived CD300a/LMIR1 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag. The total length of CD300a/LMIR1 Protein, Human (HEK293, Fc-His) is 161 a.a., with molecular weight of ~75.0 kDa.

Background

CD300a/LMIR1, an inhibitory receptor, potentially plays a role in diminishing cytolytic activity in natural killer (NK) cells and suppressing mast cell degranulation. Additionally, it acts as a negative regulator in Toll-like receptor (TLR) signaling mediated by MYD88, although not TRIF, by activating PTPN6. Upon tyrosine phosphorylation, CD300a/LMIR1 engages with PTN6/SHP-1 and PTPN11/SHP-2, as well as INPP5D, illustrating its multifaceted involvement in immune regulation and cellular responses.

Species

Human

Source

HEK293

Tag

C-hFc;C-6*His

Accession

Q9UGN4 (L18-Q178)

Gene ID
Molecular Construction
N-term
CD300A (L18-Q178)
Accession # Q9UGN4
6*His-hFc
C-term
Synonyms
CMRF35-like molecule 8; CD300 antigen-like family member A; CMRF-35-H9; CMRF35-H; IRC1/IRC2; Immunoglobulin superfamily member 12; Inhibitory receptor protein 60; NK inhibitory receptor
AA Sequence

LSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKTSTITTAFPPVSSTTLFAVGATHSASIQEETEEVVNSQ

Molecular Weight

Approximately 75.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD300a/LMIR1 Protein, Human (HEK293, Fc-His)
Cat. No.:
HY-P70754
Quantity:
MCE Japan Authorized Agent: