CD99L2 Protein, Mouse (HEK293, His)

CD99L2 Protein is crucial in aiding leukocytes during a late stage of extravasation by facilitating the overcoming of the endothelial basement membrane barrier. Independently acting at the same site as PECAM1, CD99L2 serves as a homophilic adhesion molecule, even though its interactions may not be essential for cell aggregation. CD99L2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD99L2 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD99L2 Protein, Mouse (HEK293, His) is 139 a.a., with molecular weight of 24-30 kDa.

The CD99L2 protein plays a vital role in facilitating a late step of leukocyte extravasation, aiding cells in overcoming the endothelial basement membrane barrier. It acts at the same site as PECAM1, although independently, to promote this process. CD99L2 functions as a homophilic adhesion molecule, although its interactions may not be necessary for cell aggregation.

Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD99L2 is coated at 2 µg/mL (100 µL/well) can blind Recombinant Mouse CD99L2. The ED₅₀ for this effect is 1.762 μg/mL.

Mouse

HEK293

C-His

Q8BIF0-1 (D26-A164)

171486  [NCBI]

DTDGFNLEDALKETSSVKQRWDHFSTTTRRPVTTRAPANPAERWDHVATTTTRRPGTTRAPSNPMELDGFDLEDALDDRNDLDGPKKPSAGEAGGWSDKDLEDIVEGGGYKPDKNKGGGGYGSNDDPGSGISTETGTIA

Approximately 24-30 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.