1. Recombinant Proteins
  2. Others
  3. CEMP1 Protein, Human (P.pastoris, His)

CEMP1 Protein, Human (P.pastoris, His)

Cat. No.: HY-P71836
Handling Instructions

CEMP1 protein may play a key role in the development of periodontal tissue, promoting the differentiation of periodontal ligament cells into cementoblasts and promoting cementum formation. CEMP1 exhibits affinity for hydroxyapatite, suggesting involvement in cementum biomineralization. CEMP1 Protein, Human (P.pastoris, His) is the recombinant human-derived CEMP1 protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CEMP1 protein may play a key role in the development of periodontal tissue, promoting the differentiation of periodontal ligament cells into cementoblasts and promoting cementum formation. CEMP1 exhibits affinity for hydroxyapatite, suggesting involvement in cementum biomineralization. CEMP1 Protein, Human (P.pastoris, His) is the recombinant human-derived CEMP1 protein, expressed by P. pastoris , with N-His labeled tag.

Background

The CEMP1 protein is implicated in potentially playing a crucial role in the development of the periodontium, the supportive tissue surrounding the teeth. It is suggested to promote the differentiation of multi-potent cells from the periodontal ligament into cementoblasts, contributing to the formation of the cementum, as evidenced by various studies. CEMP1 exhibits an affinity for hydroxyapatite and may play a role in promoting the biomineralization of the cementum, further underlining its potential involvement in the mineralization processes of dental tissues. Additionally, CEMP1 is associated with the promotion of cell proliferation, as supported by multiple studies. The multifaceted functions of CEMP1 in periodontal development and tissue mineralization emphasize its significance in dental biology, warranting further exploration to unravel its specific mechanisms and regulatory roles in these processes.

Species

Human

Source

P. pastoris

Tag

N-His

Accession

Q6PRD7 (M1-G247)

Gene ID
Molecular Construction
N-term
His
CEMP1 (M1-G247)
Accession # Q6PRD7
C-term
Synonyms
Cementoblastoma-derived protein 1; Cementum protein 1; Cementum protein 23; CEMP1; CP-23; CP23
AA Sequence

MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPHTSQEVRIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTARVCHMGVCQGQGDTEDGRMTLMG

Molecular Weight

Approximately 28.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CEMP1 Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CEMP1 Protein, Human (P.pastoris, His)
Cat. No.:
HY-P71836
Quantity:
MCE Japan Authorized Agent: