1. Recombinant Proteins
  2. Receptor Proteins
  3. Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. Collectin Liver 1
  6. CL-L1/COLEC10 Protein, Mouse (HEK293, Fc)

CL-L1/COLEC10 Protein, Mouse (HEK293, Fc)

Cat. No.: HY-P76845
COA Handling Instructions

CL-L1/COLEC10, operating as a lectin, displays distinct sugar-binding preferences, with a hierarchy of galactose > mannose = fucose > N-acetylglucosamine > N-acetylgalactosamine. Apart from its sugar-binding role, CL-L1/COLEC10 functions as a chemoattractant, suggesting potential engagement in the modulation of cell migration. CL-L1/COLEC10 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CL-L1/COLEC10 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of CL-L1/COLEC10 Protein, Mouse (HEK293, Fc) is 159 a.a., with molecular weight of 53-57 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $30 In-stock
5 μg $50 In-stock
10 μg $75 In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CL-L1/COLEC10, operating as a lectin, displays distinct sugar-binding preferences, with a hierarchy of galactose > mannose = fucose > N-acetylglucosamine > N-acetylgalactosamine. Apart from its sugar-binding role, CL-L1/COLEC10 functions as a chemoattractant, suggesting potential engagement in the modulation of cell migration. CL-L1/COLEC10 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CL-L1/COLEC10 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of CL-L1/COLEC10 Protein, Mouse (HEK293, Fc) is 159 a.a., with molecular weight of 53-57 kDa.

Background

CL-L1 (COLEC10) is a lectin protein with a high binding affinity for various sugars, displaying specificity in the following order: galactose > mannose = fucose > N-acetylglucosamine > N-acetylgalactosamine. As a lectin, CL-L1 likely plays a role in sugar recognition and binding, and its diverse sugar specificity suggests potential involvement in various cellular processes. Notably, CL-L1 acts as a chemoattractant, implying a probable role in the regulation of cell migration. The ability of CL-L1 to attract cells suggests its participation in the modulation of cellular movements, possibly influencing processes such as immune cell trafficking or tissue repair. The sugar-binding specificity and chemoattractant properties of CL-L1 highlight its potential significance in mediating interactions between cells and their microenvironment, emphasizing its role in cellular responses and migration regulation (adapted from the provided passage).

Biological Activity

Immobilized Recombinant Human Integrin alpha X beta 2 Protein Protein at 5 µg/mL (100 µL/well) can bind Biotinylated Mouse CL-L1 protein. The ED50 for this effect is 2.839 μg/mL, corresponding to a specific activity is 352.237 Unit/mg.

  • Immobilized Recombinant Human Integrin alpha X beta 2 Protein Protein at 5 µg/mL (100 µL/well) can bind Biotinylated Mouse CL-L1 protein. The ED50 for this effect is 2.839 μg/mL, corresponding to a specific activity is 352.237 Unit/mg.
Species

Mouse

Source

HEK293

Tag

N-hFc

Accession

Q8CF98 (C119-K277)

Gene ID

239447  [NCBI]

Molecular Construction
N-term
hFc
CL-L1 (C119-K277)
Accession # Q8CF98
C-term
Synonyms
Collectin-10; Collectin liver protein 1; CL-L1
AA Sequence

CDCGRYRKVVGQLDISVARLKTSMKFIKNVIAGIRETEEKFYYIVQEEKNYRESLTHCRIRGGMLAMPKDEVVNTLIADYVAKSGFFRVFIGVNDLEREGQYVFTDNTPLQNYSNWKEEEPSDPSGHEDCVEMLSSGRWNDTECHLTMYFVCEFVKKKK

Molecular Weight

Approximately 53-57 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CL-L1/COLEC10 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CL-L1/COLEC10 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P76845
Quantity:
MCE Japan Authorized Agent: