1. Recombinant Proteins
  2. Others
  3. CLIC5 Protein, Human (His)

CLIC5 Protein, Human (His)

Cat. No.: HY-P70113
Handling Instructions

The CLIC5 protein is essential for normal hearing and contributes to the formation of stereocilia and the development of the organ of Corti in the inner ear. It forms poorly selective ion channels that may transport chloride ions. CLIC5 Protein, Human (His) is the recombinant human-derived CLIC5 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CLIC5 protein is essential for normal hearing and contributes to the formation of stereocilia and the development of the organ of Corti in the inner ear. It forms poorly selective ion channels that may transport chloride ions. CLIC5 Protein, Human (His) is the recombinant human-derived CLIC5 protein, expressed by E. coli , with N-6*His labeled tag.

Background

CLIC5 protein is essential for normal hearing, as it is necessary for the formation of stereocilia in the inner ear and the proper development of the organ of Corti. It has the ability to insert into membranes and form ion channels that are poorly selective, possibly transporting chloride ions. Moreover, CLIC5 may play a role in regulating the absorption and secretion of ions across epithelial cells. It is also crucial for the development and maintenance of the appropriate architecture of glomerular endothelial cells and podocytes in the kidney. Additionally, CLIC5 contributes to the formation of the lens suture in the eye, which is vital for maintaining the lens's optical properties. It is a component of a complex comprising various cytoskeletal proteins, including actin, ezrin, alpha-actinin, gelsolin, and IQGAP1, and interacts with AKAP9.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9NZA1-2 (M1-S251)

Gene ID
Molecular Construction
N-term
6*His
CLIC5 (M1-S251)
Accession # Q9NZA1-2
C-term
Synonyms
rHuChloride intracellular channel protein 5/CLIC5, His; Chloride Intracellular Channel Protein 5; CLIC5
AA Sequence

MTDSATANGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS

Molecular Weight

Approximately 32.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CLIC5 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CLIC5 Protein, Human (His)
Cat. No.:
HY-P70113
Quantity:
MCE Japan Authorized Agent: