1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. CNDP1 Protein, Mouse (HEK293, His)

CNDP1 Protein, Mouse (HEK293, His)

Cat. No.: HY-P76272
COA Handling Instructions

The CNDP1 protein is critical in cellular processes and catalyzes the hydrolysis of the Xaa-His dipeptide, with the highest activity against carnosine and anserine. This enzyme specificity highlights the critical role of CNDP1 in regulating the breakdown of specific dipeptides, especially those involving histidine. CNDP1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CNDP1 protein, expressed by HEK293 , with C-His labeled tag. The total length of CNDP1 Protein, Mouse (HEK293, His) is 492 a.a., with molecular weight of ~57 KDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $50 In-stock
10 μg $85 In-stock
50 μg $215 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CNDP1 protein is critical in cellular processes and catalyzes the hydrolysis of the Xaa-His dipeptide, with the highest activity against carnosine and anserine. This enzyme specificity highlights the critical role of CNDP1 in regulating the breakdown of specific dipeptides, especially those involving histidine. CNDP1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CNDP1 protein, expressed by HEK293 , with C-His labeled tag. The total length of CNDP1 Protein, Mouse (HEK293, His) is 492 a.a., with molecular weight of ~57 KDa.

Background

The CNDP1 protein plays a crucial role in cellular processes by catalyzing the hydrolysis of peptide bonds in Xaa-His dipeptides, exhibiting the highest enzymatic activity towards substrates such as carnosine (beta-alanyl-L-histidine) and anserine (beta-alanyl-3-methyl-histidine). Through its peptide bond hydrolysis activity, CNDP1 contributes to the cleavage of dipeptides, particularly those involving histidine, and is particularly efficient in processing carnosine and anserine. This enzymatic specificity underscores the significance of CNDP1 in regulating the breakdown of specific dipeptides and suggests its potential role in modulating cellular levels of bioactive peptides derived from such hydrolytic reactions.

Biological Activity

Measured by its ability to cleave 2mM carnosine (beta-Ala-L-His) in a two-step assay for 30 min at 25°C. The specific activity is 3557.59 pmol/min/μg.

Species

Mouse

Source

HEK293

Tag

C-10*His

Accession

Q8BUG2 (M1-Y492)

Gene ID

338403  [NCBI]

Molecular Construction
N-term
CNDP1 (M1-Y492)
Accession # Q8BUG2
His
C-term
Synonyms
Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Cn1
AA Sequence

MFSSAHSGLLEKLFHYIDLHQDEFVQTLKEWVAIESDSVQPVPRLRQKLFQMMALAADKLRNLGAGVESIDLGSQQMPDGQSLPIPPILLAELGSDPEKPTVCFYGHLDVQPAQKDDGWLTDPYTLTEVDGKLYGRGATDNKGPVLAWINAVSTFRALQQDLPVNIKFILEGMEEAGSIALEELVMREKDHFFSSVDYIVISDNLWLSQRKPALTYGTRGNCYFTVEVKCRDQDFHSGTFGGILNEPMADLVALLGSLVDSSGHILIPGIYDQMAPITEGEKTMYKNIDMDLEEYQNINQVEKFLFDTKEELLMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVLGKFSIRLVPTMSPSVVEKQVTQHLEAVFSKRNSFNKMAVSMVLGLHPWTANVNDTQYLAAQRTIKTVFGVNPDMIRDGSTIPIAKIFQAITQKSVMMLPLGAVDDGEHSQNEKINRWNYIQGSKLFAAFFLELSKQHSGHQMPSSVY

Molecular Weight

Approximately 57 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 5% trehalose and 5% mannitol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CNDP1 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CNDP1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P76272
Quantity:
MCE Japan Authorized Agent: