1. Recombinant Proteins
  2. Others
  3. COL6A3 Protein, Human (HEK293, His)

COL6A3 Protein, Human (HEK293, His)

Cat. No.: HY-P75685
Handling Instructions

COL6A3 protein is an important component of type VI collagen and has the function of a cell-binding protein. Collagen VI trimers are composed of three distinct chains: alpha-1(VI), alpha-2(VI), and alpha-3(VI), alpha-5(VI), or alpha-6(VI). COL6A3 Protein, Human (HEK293, His) is the recombinant human-derived COL6A3 protein, expressed by HEK293 , with N-His labeled tag. The total length of COL6A3 Protein, Human (HEK293, His) is 77 a.a., with molecular weight of ~13 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

COL6A3 Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

COL6A3 protein is an important component of type VI collagen and has the function of a cell-binding protein. Collagen VI trimers are composed of three distinct chains: alpha-1(VI), alpha-2(VI), and alpha-3(VI), alpha-5(VI), or alpha-6(VI). COL6A3 Protein, Human (HEK293, His) is the recombinant human-derived COL6A3 protein, expressed by HEK293 , with N-His labeled tag. The total length of COL6A3 Protein, Human (HEK293, His) is 77 a.a., with molecular weight of ~13 kDa.

Background

The COL6A3 protein, part of the collagen VI family, functions as a cell-binding protein. Its structure comprises trimers consisting of three distinct chains: alpha-1(VI), alpha-2(VI), and either alpha-3(VI), alpha-5(VI), or alpha-6(VI). This trimeric composition reflects the diverse nature of collagen VI, allowing for variations in the alpha chains. Notably, collagen VI serves as an essential mediator in cell adhesion processes. The trimeric arrangement, with its distinct alpha chain combinations, underscores the versatility and adaptability of COL6A3 in facilitating cell interactions and highlights its significance in various physiological contexts. (

Species

Human

Source

HEK293

Tag

N-His

Accession

P12111-1 (T3101-T3177)

Gene ID
Molecular Construction
N-term
His
COL6A3 (T3101-T3177)
Accession # P12111-1
C-term
Synonyms
Collagen alpha-3(VI) chain; COL6A3
AA Sequence

TEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT

Molecular Weight

Approximately 13 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

COL6A3 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
COL6A3 Protein, Human (HEK293, His)
Cat. No.:
HY-P75685
Quantity:
MCE Japan Authorized Agent: