CSAG1 Protein, Human (HEK293, Fc)

CSAG1 Protein is a potential key player in maintaining centrosome integrity during mitosis, impacting chromosome segregation. The mechanisms underlying its contribution to centrosome stability require elucidation. Its putative involvement highlights significance in mitosis-related cellular events. Further research is essential to unravel precise details of CSAG1's function and its implications for centrosome integrity during mitosis. CSAG1 Protein, Human (HEK293, Fc) is the recombinant human-derived CSAG1 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of CSAG1 Protein, Human (HEK293, Fc) is 59 a.a., with molecular weight of ~34 kDa.

CSAG1 Protein emerges as a potential key player, suggesting its crucial role in maintaining centrosome integrity during mitosis. The specific mechanisms and molecular interactions through which CSAG1 contributes to the intricate processes associated with centrosome stability remain to be fully elucidated. Its putative involvement underscores its significance in cellular events related to mitosis, indicating a potential impact on the proper segregation of chromosomes and overall cell division. Further research is essential to unravel the precise details of CSAG1's function and its implications in ensuring the integrity and functionality of centrosomes during the dynamic process of mitosis.

Human

HEK293

N-hFc

Q6PB30-1 (D20-P78)

158511  [NCBI]

DQVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQPRREKGPVKEVPGTKGSP

Approximately 34 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.