1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. CTAP-III/CXCL7
  6. CXCL7 Protein, Cynomolgus (HEK293, Fc)

CXCL7 Protein, Cynomolgus (HEK293, Fc)

Cat. No.: HY-P76854
COA Handling Instructions

CXCL7 (also known as neutrophil activating peptide 2, NAP-2) is a platelet-derived growth factor that belongs to the ELR+ CXC chemokine family, functioning as a potent chemoattractant and activator of neutrophils through binding to its receptor CXCR2. CXCL7 Protein, Cynomolgus (HEK293, Fc) is produced in HEK293 cells with a N-Terminal Fc-tag. It consists of 70 amino acids (T59-D128).

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $88 In-stock
50 μg $245 In-stock
100 μg $420 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CXCL7 (also known as neutrophil activating peptide 2, NAP-2) is a platelet-derived growth factor that belongs to the ELR+ CXC chemokine family, functioning as a potent chemoattractant and activator of neutrophils through binding to its receptor CXCR2[1]. CXCL7 Protein, Cynomolgus (HEK293, Fc) is produced in HEK293 cells with a N-Terminal Fc-tag. It consists of 70 amino acids (T59-D128).

Background

CXCL7 is an important chemoattractant cytokine, which signals through binding to its receptor CXCR2. Many cells, including leucocytes and stromal cells, express CXCL7. CXCL7 is a potent chemoattractant and activator of neutrophil function[1][2].
CXCL7, a member of the CXC chemokine subfamily, is translated as a proprotein and cleaved into several smaller forms, each with particular functions. In humans, the CXCL7 gene is translated as a 14 kDa proprotein, designated leucocytederived growth factor (LDGF), which is cleaved into several smaller forms, platelet basic protein (PBP), connective tissue activating protein III (CTAP-III) and β-thrombogulin (β-TG), and NAP-2. The longest form, PBP or LDGF, is expressed in platelets and megakaryocytes and is reported to be a fibroblast mitogen. CTAP-III is a 85 amino acid protein and can be converted to 70 amino acid NAP-2 by enzymatic removal of 15 residues. CTAP-III is suggested to support megakaryocyte maturation and platelet production and is involved in resistance to mycobacteria by augmenting reactive oxygen production. NAP-2, the smallest protein in this series, is a neutrophil-activating mediator, stimulating functions such as lysosomal enzyme degranulation, but is reported to inhibit megakaryocytopoiesis[2].
CXCL7 has been demonstrated to participate in a variety of cellular processes, such as DNA synthesis, glycolysis, mitosis, intracellular cAMP accumulation, prostaglandin E2 secretion, as well as the synthesis of hyaluronic acid and plasminogen activator. Moreover, it is also an antimicrobial protein with bactericidal and antifungal activity. Recently, CXCL7 has been found to be deregulated in human cancers, and plays a role in tumor growth. For instance, CXCL7 is found to promote the growth of clear cell renal cell carcinoma. The CXCL7/CXCR2 signaling plays a promoting role in several common malignancies, including lung, renal, colon, and breast cancer[1].

Biological Activity

Determined by its ability to chemoattract THP-1 cells. The ED50 for this effect is 17.67 ng/mL, corresponding to a specific activity is 5.66×104 U/mg.

  • Determined by its ability to chemoattract THP-1 cells. The ED50 for this effect is 17.67 ng/mL, corresponding to a specific activity is 5.66×104 U/mg.
Species

Cynomolgus

Source

HEK293

Tag

N-mFc

Accession

F6SCP6 (T59-D128)

Gene ID

703334  [NCBI]

Molecular Construction
N-term
mFc
CXCL7 (T59-D128)
Accession # F6SCP6
C-term
Synonyms
C-X-C motif chemokine 7; PBP; LDGF; MDGF; CTAP-III; PPBP; NAP-2; CXCL7
AA Sequence

TELRCLCMKTTSGIHPKNIQSLEVIGKGIHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD

Molecular Weight

Approximately 40 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

CXCL7 Protein, Cynomolgus (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CXCL7 Protein, Cynomolgus (HEK293, Fc)
Cat. No.:
HY-P76854
Quantity:
MCE Japan Authorized Agent: