1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. DCUN1D2 Protein, Human (His)

DCUN1D2 Protein, Human (His)

Cat. No.: HY-P76866
COA Handling Instructions

The DCUN1D2 protein transfers NEDD8 from NEDD8-conjugated E2 to the cullin-RBX complex and regulates SCF-type complex activity. DCUN1D2 Protein, Human (His) is the recombinant human-derived DCUN1D2 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $40 In-stock
10 μg $70 In-stock
50 μg $200 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The DCUN1D2 protein transfers NEDD8 from NEDD8-conjugated E2 to the cullin-RBX complex and regulates SCF-type complex activity. DCUN1D2 Protein, Human (His) is the recombinant human-derived DCUN1D2 protein, expressed by E. coli , with N-His labeled tag.

Background

DCUN1D2 protein plays a crucial role in the neddylation process of all cullins, facilitating the transfer of NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzymes to various cullin C-terminal domain-RBX complexes. This function is essential for regulating the activity of SCF (SKP1-CUL1-F-box protein)-type complexes. Through its DCUN1 domain, DCUN1D2 interacts with unneddylated cullins, including CUL1, CUL2, CUL3, CUL4A, CUL4B, and CUL5. The specificity of these interactions is influenced by the identity of the cullin, dictating the affinity of the interaction. DCUN1D2 may also engage with regulators or subunits of cullin-RING ligases, such as RBX1, RNF7, ELOB, and DDB1, with these interactions being mediated by cullins. Additionally, DCUN1D2 forms complexes with CAND1, inhibiting the neddylation of CUL3. Notably, the CAND1-cullin-DCNL complexes undergo neddylation only in the presence of a substrate adapter. Furthermore, DCUN1D2 interacts with the N-terminally acetylated forms of UBE2M and UBE2F, highlighting its involvement in intricate protein-protein interactions within the neddylation pathway.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q6PH85-1 (M1-F259)

Gene ID

55208  [NCBI]

Molecular Construction
N-term
His
DCUN1D2 (M1-F259)
Accession # Q6PH85-1
C-term
Synonyms
DCN1-like protein 2; DCNL2; C13orf17; DCUN1L2
AA Sequence

MHKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVTGGKRSLF

Molecular Weight

Approximately 30 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 20% Glycerol, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

DCUN1D2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DCUN1D2 Protein, Human (His)
Cat. No.:
HY-P76866
Quantity:
MCE Japan Authorized Agent: