1. Recombinant Proteins
  2. Others
  3. ECM1 Protein, Mouse (HEK293, His)

ECM1 Protein, Mouse (HEK293, His)

Cat. No.: HY-P75265
COA Handling Instructions

ECM1 Protein, an extracellular matrix protein, is involved in various biological processes, including skin development, wound healing, and angiogenesis. It supports cell adhesion and migration, and regulates the structure and function of the extracellular matrix. Understanding the functions of ECM1 Protein is important for studying tissue remodeling and developing therapeutic strategies for ECM1-related disorders and diseases. ECM1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ECM1 protein, expressed by HEK293 , with C-His labeled tag. The total length of ECM1 Protein, Mouse (HEK293, His) is 540 a.a., with molecular weight of 80-95 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $45 In-stock
10 μg $70 In-stock
50 μg $185 In-stock
100 μg $295 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ECM1 Protein, an extracellular matrix protein, is involved in various biological processes, including skin development, wound healing, and angiogenesis. It supports cell adhesion and migration, and regulates the structure and function of the extracellular matrix. Understanding the functions of ECM1 Protein is important for studying tissue remodeling and developing therapeutic strategies for ECM1-related disorders and diseases. ECM1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ECM1 protein, expressed by HEK293 , with C-His labeled tag. The total length of ECM1 Protein, Mouse (HEK293, His) is 540 a.a., with molecular weight of 80-95 kDa.

Background

ECM1, a multifaceted protein, serves as a crucial participant in endochondral bone formation, acting as a negative regulator of bone mineralization. Beyond its role in bone development, ECM1 demonstrates its influence on vascular processes by stimulating endothelial cell proliferation and promoting angiogenesis. Furthermore, the protein exhibits inhibitory effects on MMP9 proteolytic activity, revealing its regulatory function in extracellular matrix remodeling. ECM1 engages in various molecular interactions, including binding to HSPG2 via its C-terminus and forming complexes with EFEMP1/FBLN3 and LAMB3. Additionally, ECM1 interacts directly with MMP9, emphasizing its involvement in the modulation of matrix metalloproteinase activity. The diverse roles and interactions of ECM1 underscore its significance in orchestrating processes related to bone formation and vascular function.

Biological Activity

1.Measured by the ability of the immobilized protein to support the adhesion of HFF Human skin fibroblast cells. When 5 × 104 cells/well are added to mECM1-His coated plates (2.5 μg/mL and 100 μL/well), approximately > 30% will adhere specifically after 90 minutes at 37°C.
2.Measured by the ability of the immobilized protein to support the adhesion of the B16F1 mouse melanoma cells. The adhesion rate for this effect is 69.70% in the presence of 10 μg/mL rmECM-1.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q61508-1 (A20-E559)

Gene ID

13601  [NCBI]

Molecular Construction
N-term
ECM1 (A20-E559)
Accession # Q61508
His
C-term
Synonyms
Extracellular matrix protein 1; Secretory component p85; Ecm1
AA Sequence

ASEGAFKASDQREMTPERLFQHLHEVGYAAPPSPPQTRRLRVDHSVTSLHDPPLFEEQREVQPPSSPEDIPVYEEDWPTFLNPNVDKAGPAVPQEAIPLQKEQPPPQVHIEQKEIDPPAQPQEEIVQKEVKPHTLAGQLPPEPRTWNPARHCQQGRRGVWGHRLDGFPPGRPSPDNLKQICLPERQHVIYGPWNLPQTGYSHLSRQGETLNVLETGYSRCCRCRSDTNRLDCLKLVWEDAMTQFCEAEFSVKTRPHLCCRLRGEERFSCFQKEAPRPDYLLRPCPVHQNGMSSGPQLPFPPGLPTPDNVKNICLLRRFRAVPRNLPATDAIQRQLQALTRLETEFQRCCRQGHNHTCTWKAWEGTLDGYCERELAIKTHPHSCCHYPPSPARDECFAHLAPYPNYDRDILTLDLSRVTPNLMGQLCGSGRVLSKHKQIPGLIQNMTIRCCELPYPEQACCGEEEKLAFIENLCGPRRNSWKDPALCCDLSPEDKQINCFNTNYLRNVALVAGDTGNATGLGEQGPTRGTDANPAPGSKEE

Molecular Weight

Approximately 80-95 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ECM1 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ECM1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P75265
Quantity:
MCE Japan Authorized Agent: