1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. Enoyl-ACP Reductase Protein, E. coli (His)

Enoyl-ACP Reductase Protein, E. coli (His)

Cat. No.: HY-P75252
COA Handling Instructions

Enoyl-ACP Reductase Protein is a member of the Short chain Dehydrogenase Reductase (SDR) superfamily. It is a key enzyme of the type II fatty acid synthesis (FAS) system. Enoyl-ACP Reductase catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP). And it is involved in the elongation cycle of fatty acid which are used in the lipid metabolism and in the biotin biosynthesis. Enoyl-ACP Reductase Protein, E. coli (His) is the recombinant E. coli-derived Enoyl-ACP Reductase protein, expressed by E. coli , with N-His labeled tag. The total length of Enoyl-ACP Reductase Protein, E. coli (His) is 261 a.a., with molecular weight of ~30 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $40 In-stock
10 μg $65 In-stock
50 μg $175 In-stock
100 μg $295 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Enoyl-ACP Reductase Protein is a member of the Short chain Dehydrogenase Reductase (SDR) superfamily. It is a key enzyme of the type II fatty acid synthesis (FAS) system. Enoyl-ACP Reductase catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP). And it is involved in the elongation cycle of fatty acid which are used in the lipid metabolism and in the biotin biosynthesis. Enoyl-ACP Reductase Protein, E. coli (His) is the recombinant E. coli-derived Enoyl-ACP Reductase protein, expressed by E. coli , with N-His labeled tag. The total length of Enoyl-ACP Reductase Protein, E. coli (His) is 261 a.a., with molecular weight of ~30 kDa.

Background

Enoyl-ACP Reductase is a member of the Short chain Dehydrogenase Reductase (SDR) superfamily and thus are closely related to the other SDR enzyme of the fatty acid synthesis cycle, 3-ketoacyl-ACP reductase, in both structure and mechanism. Enoyl-ACP Reductase is a key enzyme of the type II fatty acid synthesis (FAS) system. Fatty acid biosynthesis is essential for survival in mammals, plants, fungi and bacteria (the archaea make isoprenoid-based lipids). Enoyl-ACP Reductase catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP). And it is involved in the elongation cycle of fatty acid which are used in the lipid metabolism and in the biotin biosynthesis[1][2].

Biological Activity

Enzymatic activity is determined by following NADH consumption. The specific activity is 1055.75 pmol/min/μg.

Species

E.coli

Source

E. coli

Tag

N-6*His

Accession

WP_000506490 (G2-K262)

Gene ID

/

Molecular Construction
N-term
His
ENR (G2-K262)
Accession # WP_000506490
C-term
Synonyms
b1288 Protein; ECK1283 Protein; envM Protein; gts Protein; JW1281 Protein; qmeA Protein
AA Sequence

GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK

Molecular Weight

Approximately 30 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Enoyl-ACP Reductase Protein, E. coli (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Enoyl-ACP Reductase Protein, E. coli (His)
Cat. No.:
HY-P75252
Quantity:
MCE Japan Authorized Agent: