1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-1
  6. FGF-1 Protein, Canine

FGF-1 Protein, Canine

Cat. No.: HY-P75194
COA Handling Instructions

The FGF-1 protein is critical in cellular regulation, coordinating key processes such as cell survival, division, angiogenesis, differentiation and migration. It exhibits potent mitogenic properties in vitro and serves as a ligand for FGFR1 and integrins. FGF-1 Protein, Canine is the recombinant canine-derived FGF-1 protein, expressed by E. coli , with tag free. The total length of FGF-1 Protein, Canine is 140 a.a., with molecular weight of ~16 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $68 In-stock
100 μg $180 Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FGF-1 protein is critical in cellular regulation, coordinating key processes such as cell survival, division, angiogenesis, differentiation and migration. It exhibits potent mitogenic properties in vitro and serves as a ligand for FGFR1 and integrins. FGF-1 Protein, Canine is the recombinant canine-derived FGF-1 protein, expressed by E. coli , with tag free. The total length of FGF-1 Protein, Canine is 140 a.a., with molecular weight of ~16 kDa.

Background

The FGF-1 protein plays a pivotal role in regulating important cellular processes such as cell survival, division, angiogenesis, differentiation, and migration. In vitro, it exhibits potent mitogenic properties and acts as a ligand for both FGFR1 and integrins. When heparin is present, FGF-1 binds to FGFR1, resulting in the dimerization and activation of FGFR1 through autophosphorylation on tyrosine residues. These phosphorylated residues serve as docking sites for interacting proteins, initiating various signaling cascades. FGF-1 also binds to integrins and forms a ternary complex with integrins and FGFR1, which is crucial for FGF-1 signaling.

Biological Activity

Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED50 for this effect is 0.2335 ng/mL, corresponding to a specific activity is 4.28×106 units/mg.

  • Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED50 for this effect is 0.2335 ng/mL, corresponding to a specific activity is 4.28×106 units/mg.
Species

Canine

Source

E. coli

Tag

Tag Free

Accession

J9NTP4 (F16-D155)

Gene ID

607724  [NCBI]

Molecular Construction
N-term
FGF-1 (F16-D155)
Accession # J9NTP4
C-term
Synonyms
Multifunctional fusion protein; HBGF-1; ECGF; FGF1; FGF-a; FGF-acidic
AA Sequence

FNLPPGNYMKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Molecular Weight

Approximately 16 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FGF-1 Protein, Canine Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-1 Protein, Canine
Cat. No.:
HY-P75194
Quantity:
MCE Japan Authorized Agent: