1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-1
  6. FGF-1 Protein, Mouse/Rat

FGF-1 Protein, Mouse/Rat

Cat. No.: HY-P70438
Handling Instructions

The FGF-1 protein plays a key role in regulating a variety of cellular processes, serving as a potent mitogen and ligand for FGFR1 and integrins. In the presence of heparin, FGF-1 binds to FGFR1, initiating dimerization and autophosphorylation, resulting in multiple signaling cascades. FGF-1 Protein, Mouse/Rat is the recombinant rat, mouse-derived FGF-1 protein, expressed by E. coli , with tag free. The total length of FGF-1 Protein, Mouse/Rat is 140 a.a., with molecular weight of ~16.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock
2 μg $35 Ask For Quote & Lead Time
10 μg $58 Ask For Quote & Lead Time
50 μg $130 Ask For Quote & Lead Time
100 μg $198 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FGF-1 protein plays a key role in regulating a variety of cellular processes, serving as a potent mitogen and ligand for FGFR1 and integrins. In the presence of heparin, FGF-1 binds to FGFR1, initiating dimerization and autophosphorylation, resulting in multiple signaling cascades. FGF-1 Protein, Mouse/Rat is the recombinant rat, mouse-derived FGF-1 protein, expressed by E. coli , with tag free. The total length of FGF-1 Protein, Mouse/Rat is 140 a.a., with molecular weight of ~16.0 kDa.

Background

The FGF-1 protein plays a crucial role in the regulation of various cellular processes, including cell survival, division, angiogenesis, differentiation, and migration. It acts as a potent mitogen and functions as a ligand for both FGFR1 and integrins. In the presence of heparin, FGF-1 binds to FGFR1, leading to dimerization and activation through autophosphorylation on tyrosine residues, which serve as docking sites for interacting proteins. This activation triggers multiple signaling cascades. FGF-1 also binds to integrin ITGAV:ITGB3, forming a ternary complex with FGFR1 and inducing the recruitment of PTPN11 to the complex, which is essential for FGF-1 signaling. It induces the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2, and AKT1, and can also stimulate angiogenesis. FGF-1 interacts with several receptors and proteins, including FGFR2, FGFR3, FGFR4, FGFBP1, S100A13, SYT1, LRRC59, CSNKA, CSNKB, and FIBP. Additionally, it forms a Cu(2+)-dependent multiprotein aggregate with S100A13 and SYT1. While the interaction of FGF-1 with LRRC59, CSNKA, and FIBP appears to be mutually exclusive, CSNKB and FIBP may cooperatively interact with FGF-1. Overall, FGF-1 plays a complex role in cellular processes through its interactions with various receptors and proteins.

Species

Rat; Mouse

Source

E. coli

Tag

Tag Free

Accession

P61148 (F16-D155)

Gene ID

14164  [NCBI]

Molecular Construction
N-term
FGF-1 (F16-D155)
Accession # P61148
C-term
Synonyms
Fibroblast Growth Factor 1; FGF-1; Acidic Fibroblast Growth Factor; aFGF; Heparin-Binding Growth Factor 1; HBGF-1; Fgf1; Fgf-1; Fgfa
AA Sequence

FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Molecular Weight

Approximately 16.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FGF-1 Protein, Mouse/Rat Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-1 Protein, Mouse/Rat
Cat. No.:
HY-P70438
Quantity:
MCE Japan Authorized Agent: