1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. FKBP7 Protein, Human (199a.a, HEK293, His)

FKBP7 Protein, Human (199a.a, HEK293, His)

Cat. No.: HY-P70949
Handling Instructions

The FKBP7 protein is a peptidyl prolyl cis-trans isomerase (PPIase) that significantly accelerates protein folding, especially in the complexities of protein synthesis. Utilizing its enzymatic abilities, FKBP7 plays a crucial role in coordinating timely conformational changes to achieve correct protein folding and maturation. FKBP7 Protein, Human (199a.a, HEK293, His) is the recombinant human-derived FKBP7 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of FKBP7 Protein, Human (199a.a, HEK293, His) is 199 a.a., with molecular weight of 25-32 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FKBP7 protein is a peptidyl prolyl cis-trans isomerase (PPIase) that significantly accelerates protein folding, especially in the complexities of protein synthesis. Utilizing its enzymatic abilities, FKBP7 plays a crucial role in coordinating timely conformational changes to achieve correct protein folding and maturation. FKBP7 Protein, Human (199a.a, HEK293, His) is the recombinant human-derived FKBP7 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of FKBP7 Protein, Human (199a.a, HEK293, His) is 199 a.a., with molecular weight of 25-32 kDa.

Background

FKBP7 Protein stands out as a peptidyl-prolyl cis-trans isomerase (PPIase) that plays a pivotal role in expediting the folding of proteins, particularly during the intricate process of protein synthesis. Harnessing its enzymatic activity, FKBP7 contributes to the dynamic and timely conformational changes essential for the correct folding and maturation of proteins. As a member of the PPIase family, FKBP7 is adept at catalyzing the cis-trans isomerization of proline imidic peptide bonds, influencing the structural dynamics of nascent or misfolded polypeptides. This functional attribute underscores the protein's significance in maintaining cellular protein homeostasis and underscores its potential impact on cellular physiology. Further investigations are warranted to unravel the specific molecular mechanisms through which FKBP7 actively participates in the intricate choreography of protein folding during synthesis.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9Y680-2 (Q24-L222)

Gene ID
Molecular Construction
N-term
FKBP7 (Q24-L222)
Accession # Q9Y680-2
6*His
C-term
Synonyms
Peptidyl-Prolyl Cis-Trans Isomerase FKBP7; PPIase FKBP7; 23 kDa FK506-Binding Protein; 23 kDa FKBP; FKBP-23; FK506-Binding Protein 7; FKBP-7; Rotamase; FKBP7; FKBP23
AA Sequence

QRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL

Molecular Weight

25-32 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FKBP7 Protein, Human (199a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FKBP7 Protein, Human (199a.a, HEK293, His)
Cat. No.:
HY-P70949
Quantity:
MCE Japan Authorized Agent: