1. Recombinant Proteins
  2. Others
  3. GLIPR1 Protein, Mouse (HEK293, His)

GLIPR1 Protein, Mouse (HEK293, His)

Cat. No.: HY-P76364
COA Handling Instructions

GLIPR1 protein is a member of the CRISP (cysteine-rich secreted protein) family and is a multifunctional protein involved in a variety of cellular processes. It is primarily known for its role in cancer development and progression. GLIPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived GLIPR1 protein, expressed by HEK293 , with C-His labeled tag. The total length of GLIPR1 Protein, Mouse (HEK293, His) is 206 a.a., with molecular weight of 27 KDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $40 In-stock
10 μg $70 In-stock
50 μg $200 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GLIPR1 protein is a member of the CRISP (cysteine-rich secreted protein) family and is a multifunctional protein involved in a variety of cellular processes. It is primarily known for its role in cancer development and progression. GLIPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived GLIPR1 protein, expressed by HEK293 , with C-His labeled tag. The total length of GLIPR1 Protein, Mouse (HEK293, His) is 206 a.a., with molecular weight of 27 KDa.

Background

GLIPR1 Protein, a member of the CRISP (cysteine-rich secretory protein) family, is a multifunctional protein involved in various cellular processes. It is primarily known for its role in cancer development and progression. GLIPR1 Protein has been implicated in regulating apoptosis (programmed cell death), cell proliferation, and cell migration. In cancer cells, GLIPR1 Protein can act as both a tumor suppressor or an oncogene, depending on the context. It can induce apoptosis and inhibit tumor growth in certain types of cancer, while promoting tumor cell survival and metastasis in others. Additionally, GLIPR1 Protein has been shown to modulate immune responses and contribute to the regulation of inflammation. Further research is needed to fully elucidate the mechanisms underlying the diverse functions of GLIPR1 Protein and its potential as a therapeutic target in cancer and other diseases.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q9CWG1/NP_082884.1 (S18-T223)

Gene ID

73690  [NCBI]

Molecular Construction
N-term
GLIPR1 (S18-T223)
Accession # Q9CWG1/NP_082884.1
His
C-term
Synonyms
Glioma Pathogenesis-Related Protein 1; GliPR 1; Protein RTVP-1; GLIPR1; GLIPR; RTVP1
AA Sequence

SSFTASTLPDITNEDFIKECVQVHNQLRSKVSPPARNMLYMSWDPKLAQIAKAWTKSCEFKHNPQLHSRIHPNFTALGENIWLGSLSIFSVSSAISAWYEEIKHYDFSTRKCRHVCGHYTQVVWADSYKLGCAVQLCPNGANFICDYGPAGNYPTWPYKQGATCSDCPKDDKCLNSLCINPRRDQVSRYYSVDYPDWPIYLRNRYT

Molecular Weight

Approximately 27 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GLIPR1 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GLIPR1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P76364
Quantity:
MCE Japan Authorized Agent: