1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. IGF family
  4. IGFBP-6
  5. IGFBP-6 Protein, Rat (HEK293, His)

IGFBP-6 Protein, Rat (HEK293, His)

Cat. No.: HY-P73905
COA Handling Instructions

IGFBP-6 protein modulates IGFs' activity, extending their half-life and exhibiting dual regulatory capacity. It activates the MAPK pathway, induces cell migration, and interacts with PHB2. These diverse functions emphasize IGFBP-6's multifaceted role in cellular responses related to growth regulation, signaling, and migration. IGFBP-6 Protein, Rat (HEK293, His) is the recombinant rat-derived IGFBP-6 protein, expressed by HEK293 , with C-His labeled tag. The total length of IGFBP-6 Protein, Rat (HEK293, His) is 201 a.a., with molecular weight of 25-30 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $70 In-stock
50 μg $200 In-stock
100 μg $340 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IGFBP-6 protein modulates IGFs' activity, extending their half-life and exhibiting dual regulatory capacity. It activates the MAPK pathway, induces cell migration, and interacts with PHB2. These diverse functions emphasize IGFBP-6's multifaceted role in cellular responses related to growth regulation, signaling, and migration. IGFBP-6 Protein, Rat (HEK293, His) is the recombinant rat-derived IGFBP-6 protein, expressed by HEK293 , with C-His labeled tag. The total length of IGFBP-6 Protein, Rat (HEK293, His) is 201 a.a., with molecular weight of 25-30 kDa.

Background

IGFBP-6 protein assumes a crucial role in modulating the activity of insulin-like growth factors (IGFs) by extending their half-life. Demonstrating a dual regulatory capacity in cell culture, IGFBP-6 can either inhibit or stimulate the growth-promoting effects of IGFs, reflecting its versatile influence on cellular processes. Beyond its impact on IGFs, IGFBP-6 actively participates in cellular signaling by activating the MAPK pathway and promoting cell migration. Notably, it interacts with PHB2 through its C-terminal domain, emphasizing its involvement in intricate protein-protein interactions. These diverse functions highlight the multifaceted role of IGFBP-6 in orchestrating cellular responses associated with growth regulation, signaling, and migration.

Biological Activity

Measured by its ability to inhibit the biological activity of IGF-I on MCF 7 human breast cancer cells. The ED50 for this effect is 0.1026 µg/mL, corresponding to a specific activity is 9746.5887 U/mg.

  • Measured by its ability to inhibit the biological activity of IGF-I on MCF 7 human breast cancer cells. The ED50 for this effect is 0.1026 µg/mL, corresponding to a specific activity is 9746.5887 U/mg.
Species

Rat

Source

HEK293

Tag

C-6*His

Accession

P35572/NP_037236.1 (A26-G226)

Gene ID

25641  [NCBI]

Molecular Construction
N-term
IGFBP-6 (A26-G226)
Accession # P35572/NP_037236.1
His
C-term
Synonyms
Insulin-like growth factor-binding protein 6; IBP-6; IGFBP-6; IBP6
AA Sequence

ALAGCPGCGPGVQEEDAGSPADGCAETGGCFRREGQPCGVYIPKCAPGLQCQPRENEETPLRALLIGQGRCQRARGPSEETTKESKPHGGASRPRDRDRQKNPRTSAAPIRPSPVQDGEMGPCRRHLDSVLQQLQTEVFRGGANGLYVPNCDLRGFYRKQQCRSSQGNRRGPCWCVDPMGQPLPVSPDGQGSSQCSARSSG

Molecular Weight

Approximately 25-30 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IGFBP-6 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IGFBP-6 Protein, Rat (HEK293, His)
Cat. No.:
HY-P73905
Quantity:
MCE Japan Authorized Agent: