IL-1RA/IL-1F3 Protein, Porcine

The IL-1RA/IL-1F3 protein, a robust anti-inflammatory antagonist in the interleukin-1 family, specifically targets proinflammatory cytokines IL1B and IL1A. Countering IL1's inflammatory effects, this protein crucially protects against immune dysregulation and prevents uncontrolled systemic inflammation triggered by various innate stimulatory agents, including pathogens. Serving as a regulatory shield against IL1-mediated responses, IL-1RA/IL-1F3 significantly contributes to maintaining immune balance and curtailing excessive inflammatory reactions. IL-1RA/IL-1F3 Protein, Porcine is the recombinant Porcine-derived IL-1RA/IL-1F3 protein, expressed by E. coli, with tag free. The total length of IL-1RA/IL-1F3 Protein, Porcine is 152 a.a., with molecular weight of ~17.55 kDa.

The IL-1RA/IL-1F3 protein serves as a potent anti-inflammatory antagonist within the interleukin-1 family, specifically targeting proinflammatory cytokines like interleukin-1beta/IL1B and interleukin-1alpha/IL1A. With its ability to counteract the inflammatory effects of IL1, this protein plays a crucial role in protecting against immune dysregulation and preventing uncontrolled systemic inflammation induced by a variety of innate stimulatory agents, including pathogens. By acting as a regulatory shield against IL1-mediated responses, IL-1RA/IL-1F3 contributes significantly to maintaining immune balance and curtailing excessive inflammatory reactions.

Measured by its ability to inhibit IL-1 alpha -dependent proliferation in CTLL-2. The ED₅₀ for this effect is 0.03295 μg/mL in the presence of 50 pg/mL of recombinant porcine IL-1 alpha, corresponding to a specific activity is 4.18×10^4 units/mg.

• 
  Measured by its ability to inhibit IL-1 alpha -dependent proliferation in CTLL-2. The ED₅₀ for this effect is 0.03295 μg/mL in the presence of 50 pg/mL of recombinant porcine IL-1 alpha, corresponding to a specific activity is 4.18×10⁴ units/mg.

Porcine

E. coli

Tag Free

Q29056 (H26-Q177)

397499  [NCBI]

HPLGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNTKLEEKIDVVPVEPHFVFLGIHGGKLCLSCVKSGDEMKLQLDAVNITDLRKNSEQDKRFTFIRSDSGPTTSFESAACPGWFLCTALEADQPVGLTNTPKAAVKVTKFYFQQDQ

Approximately 17.55 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.