1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-17
  5. IL-25/IL-17E
  6. IL-25/IL-17E Protein, Rat (HEK293, Fc)

IL-25/IL-17E Protein, Rat (HEK293, Fc)

Cat. No.: HY-P74812
COA Handling Instructions

IL-25/IL-17E is a member of the IL-17 family. IL-25/IL-17E Protein, Rat (HEK293, Fc) is the recombinant rat-derived IL-25/IL-17E protein, expressed by HEK293 , with N-hFc labeled tag. The total length of IL-25/IL-17E Protein, Rat (HEK293, Fc) is 153 a.a., with molecular weight of ~50 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $37 In-stock
10 μg $105 In-stock
50 μg $290 In-stock
100 μg $490 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-25/IL-17E is a member of the IL-17 family. IL-25/IL-17E Protein, Rat (HEK293, Fc) is the recombinant rat-derived IL-25/IL-17E protein, expressed by HEK293 , with N-hFc labeled tag. The total length of IL-25/IL-17E Protein, Rat (HEK293, Fc) is 153 a.a., with molecular weight of ~50 kDa.

Background

IL-25, also known as IL-17E, is a member of the IL-17 family.

Biological Activity

Measured by its ability to induce CXCL1 secretion in HT-29 human colon adenocarcinoma cells. The ED50 for this effect is 0.2944 ng/mL, corresponding to a specific activity is 3.397×106 U/mg.

Species

Rat

Source

HEK293

Tag

N-hFc

Accession

D3ZLB1 (V17-A169)

Gene ID

501996  [NCBI]

Molecular Construction
N-term
hFc
IL-17E (V17-A169)
Accession # D3ZLB1
C-term
Synonyms
Interleukin-25; IL-25; Interleukin-17E; IL-17E
AA Sequence

VSLRIQEDCSHLPRCCPSKQQEFPEEWLKWNPAPVSPPEPLRHTHHPESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPMGNSVPLYHNQTVFYRRPCHGEQGAHGRYCLERRLYRVSLACVCVRPRMMA

Molecular Weight

Approximately 50 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-25/IL-17E Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P74812
Quantity:
MCE Japan Authorized Agent: