1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Stem Cell CD Proteins Platelet CD Proteins Erythrocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. Integrin Associated Protein/CD47
  5. CD47 Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)

CD47 Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)

Cat. No.: HY-P7831
COA Handling Instructions

CD47 is a leukocyte surface antigen, and high expression of CD47 helps tumors escape. CD47 inhibition leads to the activation of CD103+ dendritic cells, which leads to the recruitment and activation of natural killer cells and inhibits cancer development. CD47 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived CD47 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD47 Protein, Rhesus Macaque (HEK293, Fc) is 121 a.a., with molecular weight of 60-90 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $60 In-stock
10 μg $95 In-stock
50 μg $250 In-stock
100 μg $400 In-stock
500 μg $1050 In-stock
1 mg $1660 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD47 is a leukocyte surface antigen, and high expression of CD47 helps tumors escape. CD47 inhibition leads to the activation of CD103+ dendritic cells, which leads to the recruitment and activation of natural killer cells and inhibits cancer development. CD47 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived CD47 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD47 Protein, Rhesus Macaque (HEK293, Fc) is 121 a.a., with molecular weight of 60-90 kDa.

Background

CD47 is a receptor for the C-terminal cell-binding domain of leukocyte surface antigen and thrombospondin. CD47 controls the increase in intracellular calcium concentration when cells adhere to the extracellular matrix and may play a role in membrane trafficking and signal transduction. The CD47 gene has broad tissue distribution and low expression on Rh erythrocytes. High expression levels of CD47 help cancer cells evade the immune system. For example, studies have found that high expression of CD47 is associated with poor prognosis in HCC patients. CD47 inhibition can enhance the ability of CD103+ DCs to take up tumor DNA, thereby stimulating the cGAS-STING pathway and promoting the infiltration and activation of liver natural killer cells in cancer cells. CD47 also binds to proteins including thrombospondin-1 (TSP-1), signal regulatory protein alpha (SIRPα), integrins, and protein tyrosine phosphatase substrate with SH2 domain-1 (SHPS-1). Ligand. and regulates phagocytosis of macrophages, migration of neutrophils, and activation of dendritic cells, T cells, and B cells. Some CD47 antibodies may inhibit the CD47-SIRPα axis to enhance phagocytosis of cancer cells.

Biological Activity

1.10 μg/mL (100 μL/well) of immobilized recombinant Rhesus Macaque Integrin-associated protein/CD47-Fc can bind Anti-Human CD47 mAb-IgG4Fc with an ED50 value of 76.1 ng/mL.
2.Measured by its binding ability in a functional ELISA. Immobilized Human SIRP alpha at 2μg/mL (100 μL/well) can bind Cynomolgus CD47. The ED50 for this effect is 0.19 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human SIRP alpha at 2μg/mL (100 μL/well) can bind Cynomolgus CD47. The ED50 for this effect is 0.19 μg/mL.
Species

Rhesus Macaque; Cynomolgus

Source

HEK293

Tag

C-hFc

Accession

F7A802/NP_001253446 (Q19-S139)

Gene ID

704980  [NCBI]

Molecular Construction
N-term
CD47 (Q19-S138)
Accession # F7A802
hFc
C-term
Synonyms
rRhIntegrin-associated protein/CD47, Fc; Leukocyte Surface Antigen CD47; Antigenic Surface Determinant Protein OA3; Integrin-Associated Protein; IAP; Protein MER6; CD47; MER6
AA Sequence

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTAPANFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFS

Molecular Weight

Approximately 60-90 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 100 mM Glycine, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD47 Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)
Cat. No.:
HY-P7831
Quantity:
MCE Japan Authorized Agent: