1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. Fibroblast Growth Factor 7 (FGF-7)
  6. KGF/FGF-7 Protein, Human (163a.a)

KGF/FGF-7 Protein, Human (163a.a)

Cat. No.: HY-P70597
COA Handling Instructions

KGF/FGF-7 proteins coordinate embryonic development and regulate basic processes such as cell proliferation and differentiation. Its critical role extends to normal branching morphogenesis. KGF/FGF-7 Protein, Human (163a.a) is the recombinant human-derived KGF/FGF-7 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $50 In-stock
10 μg $140 In-stock
50 μg $400 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KGF/FGF-7 proteins coordinate embryonic development and regulate basic processes such as cell proliferation and differentiation. Its critical role extends to normal branching morphogenesis. KGF/FGF-7 Protein, Human (163a.a) is the recombinant human-derived KGF/FGF-7 protein, expressed by E. coli , with tag free.

Background

KGF/FGF-7 Protein assumes a crucial role in orchestrating embryonic development, exhibiting regulatory control over fundamental processes encompassing cell proliferation and differentiation. Its essential contribution extends to the intricate realm of normal branching morphogenesis, where KGF/FGF-7 plays a pivotal role. As a growth factor specifically active on keratinocytes, it emerges as a potential major paracrine effector governing normal epithelial cell proliferation. The protein establishes key interactions, forming complexes with FGFBP1 and FGFR2, and its binding affinity with fibroblast growth factors (FGFs) and their receptors is augmented by heparan sulfate glycosaminoglycans, acting as critical coreceptors in these molecular interactions.

Biological Activity

Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells.The ED50 for this effect is ≤110.3 ng/mL, corresponding to a specific activity is ≥9.07×103 U/mg.

  • Measured in a cell proliferation assay using 4MBr‑5 rhesus monkey epithelial cells.The ED50 for this effect is 15.20 ng/mL, corresponding to a specific activity is 6.6×104 U/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P21781-1 (C32-T194)

Gene ID
Molecular Construction
N-term
FGF-7 (C32-T194)
Accession # P21781
C-term
Synonyms
Fibroblast growth factor 7; FGF-7; Heparin-binding growth factor 7; HBGF-7; Keratinocyte growth factor; FGF7; KGF
AA Sequence

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Molecular Weight

Approximately 18-20 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 1mM EDTA, 5% Trehalose, 0.02% Tween 80, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCL, pH 7.4 or PBS or 50 mM Tris-HCL, 300 mM NaCl, pH 8.0, 5 % trehalose, 5 % mannitol and 0.01% Tween80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KGF/FGF-7 Protein, Human (163a.a)
Cat. No.:
HY-P70597
Quantity:
MCE Japan Authorized Agent: