1. Recombinant Proteins
  2. CD Antigens
  3. LAMP3/CD208 Protein, Human (HEK293, His)

LAMP3/CD208 Protein, Human (HEK293, His)

Cat. No.: HY-P77435
COA Handling Instructions

LAMP3/CD208 is a lysosomal glycoprotein that participates in the unfolded protein response (UPR) and contributes to protein degradation and cell survival, especially in the presence of proteasome dysfunction. It crucially promotes lysosome-autophagosome fusion and regulates autophagy. LAMP3/CD208 Protein, Human (HEK293, His) is the recombinant human-derived LAMP3/CD208 protein, expressed by HEK293 , with C-His labeled tag. The total length of LAMP3/CD208 Protein, Human (HEK293, His) is 354 a.a., with molecular weight of 70-100 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $40 In-stock
10 μg $70 In-stock
50 μg $200 In-stock
100 μg $340 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LAMP3/CD208 is a lysosomal glycoprotein that participates in the unfolded protein response (UPR) and contributes to protein degradation and cell survival, especially in the presence of proteasome dysfunction. It crucially promotes lysosome-autophagosome fusion and regulates autophagy. LAMP3/CD208 Protein, Human (HEK293, His) is the recombinant human-derived LAMP3/CD208 protein, expressed by HEK293 , with C-His labeled tag. The total length of LAMP3/CD208 Protein, Human (HEK293, His) is 354 a.a., with molecular weight of 70-100 kDa.

Background

LAMP3/CD208, a lysosomal membrane glycoprotein, is involved in the unfolded protein response (UPR), contributing to protein degradation and cell survival particularly during proteasomal dysfunction. Additionally, it plays a crucial role in the fusion process between lysosomes and autophagosomes, thereby modulating autophagy. LAMP3/CD208 has been identified as a promoter of hepatocellular lipogenesis through the activation of the PI3K/Akt pathway. Furthermore, it is implicated in dendritic cell function and adaptive immunity. In the context of microbial infection, LAMP3/CD208 plays a positive role in post-entry steps of influenza A virus replication, influencing processes such as virus uncoating, cytosolic transport, or nuclear import of viral components, and contributing to the nuclear accumulation of influenza nucleoprotein/NP during the early stages of viral infection.

Biological Activity

Measured by its ability to enhance MDA-MB-231 cells migration. The ED50 for this effect is 0.401μg/mL, corresponding to a specific activity is 2.494×103 U/mg.

  • Measured by its ability to enhance MDA-MB-231 cells migration. The ED50 for this effect is 0.401μg/mL, corresponding to a specific activity is 2.494×103 U/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9UQV4/NP_055213.2 (K28-T381)

Gene ID
Molecular Construction
N-term
LAMP3 (K28-T381)
Accession # Q9UQV4/NP_055213.2
His
C-term
Synonyms
Lysosome-associated membrane glycoprotein 3; LAMP-3; DCLAMP; TSC403
AA Sequence

KAFPETRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETIYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECSSDYT

Molecular Weight

Approximately 70-100 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LAMP3/CD208 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LAMP3/CD208 Protein, Human (HEK293, His)
Cat. No.:
HY-P77435
Quantity:
MCE Japan Authorized Agent: