1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. TGF-beta Receptor
  5. Lefty-A/TGF-beta 4 Protein, Human (HEK293, His)

Lefty-A/TGF-beta 4 Protein, Human (HEK293, His)

Cat. No.: HY-P70191
COA Handling Instructions

Lefty-A, or TGF-beta 4, plays a crucial role in determining left-right (L-R) asymmetry in mammalian organ systems. Its implication in endometrial bleeding suggests a potential role in reproductive processes, highlighting its significance beyond embryonic development. Lefty-A/TGF-beta 4 Protein, Human (HEK293, His) is the recombinant human-derived Lefty-A/TGF-beta 4 protein, expressed by HEK293 , with N-6*His labeled tag. The total length of Lefty-A/TGF-beta 4 Protein, Human (HEK293, His) is 289 a.a., with molecular weight of ~45-50 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $50 In-stock
50 μg $150 In-stock
100 μg $255 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Lefty-A, or TGF-beta 4, plays a crucial role in determining left-right (L-R) asymmetry in mammalian organ systems. Its implication in endometrial bleeding suggests a potential role in reproductive processes, highlighting its significance beyond embryonic development. Lefty-A/TGF-beta 4 Protein, Human (HEK293, His) is the recombinant human-derived Lefty-A/TGF-beta 4 protein, expressed by HEK293 , with N-6*His labeled tag. The total length of Lefty-A/TGF-beta 4 Protein, Human (HEK293, His) is 289 a.a., with molecular weight of ~45-50 kDa.

Background

Lefty-A, also known as TGF-beta 4, is crucial for the determination of left-right (L-R) asymmetry in organ systems within mammals. Its involvement in endometrial bleeding suggests a potential role in reproductive processes, emphasizing its significance beyond embryonic development.

Species

Human

Source

HEK293

Tag

N-6*His

Accession

O00292 (F78-P366)

Gene ID
Molecular Construction
N-term
6*His
Lefty-A (F78-P366)
Accession # O00292
C-term
Synonyms
rHuLeft-right determination factor 2, His; Left-right determination factor 2; Endometrial bleeding-associated factor; Left-right determination factor A; Protein lefty-2; Protein lefty-A; Transforming growth factor beta-4; TGF-beta-4; LEFTY2; EBAF; LEFTA; LEFTYA; TGFB4
AA Sequence

FSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP

Molecular Weight

45-50 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Histidine-HCl, 4% Sucrose, 4% Mannitol, 0.1% Tween80, pH 6.0 or 20 mM His-HCl, 10% Trehalose, 4% Mannitol, 100 mM NaCl, 0.1% Tween 80, pH 5.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Lefty-A/TGF-beta 4 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Lefty-A/TGF-beta 4 Protein, Human (HEK293, His)
Cat. No.:
HY-P70191
Quantity:
MCE Japan Authorized Agent: