1. Recombinant Proteins
  2. Others
  3. Meteorin Protein, Mouse (HEK293, Fc)

Meteorin Protein, Mouse (HEK293, Fc)

Cat. No.: HY-P76493
Handling Instructions

Meteorin, a multifunctional protein, is pivotal in neurogenesis, influencing glial cell differentiation and axonal network formation. It promotes astrocyte differentiation, transforms cerebellar astrocytes into radial glia, and induces axonal extension in sensory ganglia neurons. As a monomeric entity, Meteorin orchestrates glial cell differentiation and axonal network formation, emphasizing its crucial role in neurogenesis. Meteorin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Meteorin protein, expressed by HEK293 , with N-hFc labeled tag. The total length of Meteorin Protein, Mouse (HEK293, Fc) is 270 a.a., with molecular weight of ~57 KDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Meteorin, a multifunctional protein, is pivotal in neurogenesis, influencing glial cell differentiation and axonal network formation. It promotes astrocyte differentiation, transforms cerebellar astrocytes into radial glia, and induces axonal extension in sensory ganglia neurons. As a monomeric entity, Meteorin orchestrates glial cell differentiation and axonal network formation, emphasizing its crucial role in neurogenesis. Meteorin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Meteorin protein, expressed by HEK293 , with N-hFc labeled tag. The total length of Meteorin Protein, Mouse (HEK293, Fc) is 270 a.a., with molecular weight of ~57 KDa.

Background

Meteorin, a multifaceted protein, plays a pivotal role in neurogenesis by contributing to both glial cell differentiation and the formation of axonal networks. Its influence extends to promoting astrocyte differentiation and orchestrating the transformation of cerebellar astrocytes into radial glia. Additionally, Meteorin exerts its effects on sensory ganglia, inducing axonal extension in small and intermediate neurons by activating neighboring satellite glia. As a monomeric entity, Meteorin acts as a key orchestrator in the intricate processes of glial cell differentiation and axonal network formation during neurogenesis.

Species

Mouse

Source

HEK293

Tag

N-hFc

Accession

Q8C1Q4-1 (G22-D291)

Gene ID

70083  [NCBI]

Molecular Construction
N-term
hFc
Meteorin (G22-D291)
Accession # Q8C1Q4
C-term
Synonyms
Meteorin; Hypoxia/reoxygenation regulatory factor; Hyrac
AA Sequence

GYSEDRCSWRGSGLTQEPGSVGQLTLDCTEGAIEWLYPAGALRLTLGGPDPGTRPSIVCLRPERPFAGAQVFAERMTGNLELLLAEGPDLAGGRCMRWGPRERRALFLQATPHRDISRRVAAFRFELHEDQRAEMSPQAQGLGVDGACRPCSDAELLLAACTSDFVIHGTIHGVAHDTELQESVITVVVARVIRQTLPLFKEGSSEGQGRASIRTLLRCGVRPGPGSFLFMGWSRFGEAWLGCAPRFQEFSRVYSAALTTHLNPCEMALD

Molecular Weight

Approximately 57-60 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Meteorin Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Meteorin Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P76493
Quantity:
MCE Japan Authorized Agent: