1. Recombinant Proteins
  2. Others
  3. MFAP3 Protein, Human (HEK293, Fc)

MFAP3 Protein, Human (HEK293, Fc)

Cat. No.: HY-P77085
COA Handling Instructions

MFAP3 (microfibril-associated protein 3) is a protein that plays a crucial role in maintaining cell structure. As a component of elastin-related microfibrils, it is essential in providing structural integrity and elasticity to various tissues in the body. MFAP3 Protein, Human (HEK293, Fc) is the recombinant human-derived MFAP3 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $35 In-stock
10 μg $60 In-stock
50 μg $170 In-stock
100 μg $290 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MFAP3 (microfibril-associated protein 3) is a protein that plays a crucial role in maintaining cell structure. As a component of elastin-related microfibrils, it is essential in providing structural integrity and elasticity to various tissues in the body. MFAP3 Protein, Human (HEK293, Fc) is the recombinant human-derived MFAP3 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

MFAP3 (Microfibril-associated protein 3) is a protein that plays a crucial role in maintaining cellular architecture. It functions as a component of elastin-associated microfibrils, which are essential for providing structural integrity and elasticity to various tissues in the body. By being involved in the formation and organization of these microfibrils, MFAP3 contributes to the overall stability and functionality of tissues that require elasticity, such as blood vessels, skin, and lungs. Understanding the role of MFAP3 can provide insights into the mechanisms underlying tissue development, maintenance, and potential diseases related to abnormalities in cellular architecture.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

P55082-1 (A19-M147)

Gene ID
Molecular Construction
N-term
MFAP3 (A19-M147)
Accession # P55082-1
hFc
C-term
Synonyms
Microfibril-associated glycoprotein 3; MFAP3
AA Sequence

AFVLEDVDFDQMVSLEANRSSYNASFPSSFELSASSHSDDDVIIAKEGTSVSIECLLTASHYEDVHWHNSKGQQLDGRSRGGKWLVSDNFLNITNVAFDDRGLYTCFVTSPIRASYSVTLRVIFTSGDM

Molecular Weight

Approximately 55-70 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MFAP3 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MFAP3 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P77085
Quantity:
MCE Japan Authorized Agent: