1. Recombinant Proteins
  2. CD Antigens
  3. NK Cell CD Proteins
  4. CD159a
  5. NKG2A Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)

NKG2A Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)

Cat. No.: HY-P77105
Handling Instructions

The NKG2A protein is an important immunosuppressive receptor that forms a complex with KLRD1 on lymphocyte subsets for self-non-self discrimination. It recognizes HLA-E loaded with self-peptides, monitors MHC class I expression in healthy cells, and promotes self-tolerance. NKG2A Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived NKG2A protein, expressed by HEK293 , with N-hFc labeled tag. The total length of NKG2A Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc) is 140 a.a., with molecular weight of 50-55 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $55 In-stock
10 μg $85 In-stock
50 μg $220 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NKG2A protein is an important immunosuppressive receptor that forms a complex with KLRD1 on lymphocyte subsets for self-non-self discrimination. It recognizes HLA-E loaded with self-peptides, monitors MHC class I expression in healthy cells, and promotes self-tolerance. NKG2A Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived NKG2A protein, expressed by HEK293 , with N-hFc labeled tag. The total length of NKG2A Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc) is 140 a.a., with molecular weight of 50-55 kDa.

Background

NKG2A Protein, an immune inhibitory receptor crucial for self-nonself discrimination, forms a complex with KLRD1 on cytotoxic and regulatory lymphocyte subsets, recognizing the non-classical major histocompatibility (MHC) class Ib molecule HLA-E loaded with self-peptides from the signal sequence of classical MHC class Ia molecules. This recognition allows cytotoxic cells to monitor MHC class I expression in healthy cells and promotes self-tolerance. Upon binding to HLA-E-peptide complexes, NKG2A transmits intracellular signals through two immunoreceptor tyrosine-based inhibition motifs (ITIMs), recruiting INPP5D/SHP-1 and INPPL1/SHP-2 tyrosine phosphatases to oppose signals from activating receptors. As a key inhibitory receptor on natural killer (NK) cells, NKG2A regulates their activation and effector functions, countering T cell receptor signaling on a subset of memory/effector CD8-positive T cells and distinguishing harmless from pathogenic antigens. In the HLA-E-rich tumor microenvironment, NKG2A acts as an immune inhibitory checkpoint, contributing to the progressive loss of effector functions in NK cells and tumor-specific T cells, a phenomenon known as cell exhaustion. Notably, during viral infection, NKG2A recognizes HLA-E in complex with human cytomegalovirus-derived peptides, inhibiting NK cell cytotoxicity and facilitating viral immune escape.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human CD94 is present at 2 μg/mL, can bind Recombinant Cynomolgus NKG2A. The ED50 for this effect is 4.181 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Human CD94 is present at 2 μg/mL, can bind Recombinant Cynomolgus NKG2A. The ED50 for this effect is 4.181 μg/mL.
Species

Rhesus Macaque

Source

HEK293

Tag

N-hFc

Accession

Q9MZJ2 (P94-L233)

Gene ID

/

Molecular Construction
N-term
hFc
NKG2A (P94-L233)
Accession # Q9MZJ2
C-term
Synonyms
NKG2-A/NKG2-B type II integral membrane protein; CD159a; KLRC1
AA Sequence

PSTLTQKHNNSSLNTRTQKACHCGHCPEEWITYSNSCYYIGKEKRTWAESLLACTLKNSSLLSIDNEEEMKFLTAISPSTWTGVFRDSSQHPWVTINGLTFKHEIKDSDNAEHNCAMLHARGLKSDRCGSSKIYHCKHKL

Molecular Weight

Approximately 50-55 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NKG2A Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NKG2A Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)
Cat. No.:
HY-P77105
Quantity:
MCE Japan Authorized Agent: