1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. PHYH Protein, Human

PHYH Protein, Human

Cat. No.: HY-P76544
COA Handling Instructions

PHYH protein catalyzes 2-hydroxylation of various mono-branched and straight-chain acyl-CoA esters, including racemic phytanoyl-CoA and isomers of 3-methylhexadecanoyl-CoA. It acts on acyl-CoAs with a chain length of at least seven carbon atoms, excluding long, very long straight-chain, and 2-methyl or 4-methyl-branched acyl-CoAs. PHYH Protein, Human is the recombinant human-derived PHYH protein, expressed by E. coli , with tag free. The total length of PHYH Protein, Human is 308 a.a., with molecular weight of 32 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
5 μg $62 In-stock
10 μg $95 In-stock
50 μg $230 In-stock
100 μg $350 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PHYH protein catalyzes 2-hydroxylation of various mono-branched and straight-chain acyl-CoA esters, including racemic phytanoyl-CoA and isomers of 3-methylhexadecanoyl-CoA. It acts on acyl-CoAs with a chain length of at least seven carbon atoms, excluding long, very long straight-chain, and 2-methyl or 4-methyl-branched acyl-CoAs. PHYH Protein, Human is the recombinant human-derived PHYH protein, expressed by E. coli , with tag free. The total length of PHYH Protein, Human is 308 a.a., with molecular weight of 32 kDa.

Background

PHYH protein plays a crucial role in cellular metabolism by catalyzing the 2-hydroxylation of various acyl-CoA esters, including racemic phytanoyl-CoA, isomers of 3-methylhexadecanoyl-CoA, and a diverse array of other mono-branched 3-methylacyl-CoA esters with a chain length of at least seven carbon atoms, as well as straight-chain acyl-CoA esters with a chain length longer than four carbon atoms. Notably, PHYH does not hydroxylate long and very long straight-chain acyl-CoAs or 2-methyl- and 4-methyl-branched acyl-CoAs, showcasing its substrate specificity. These enzymatic activities contribute to the regulation of lipid metabolism and cellular homeostasis, highlighting the importance of PHYH in maintaining metabolic balance.

Biological Activity

Measured by its ability to catalyze a reaction to produce inorganic phosphates at 37°C for 30 min. The specific activity is 1104.22 pmol/min/mg.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

O14832-1 (S31-L338)

Gene ID
Molecular Construction
N-term
PHYH (S31-L338)
Accession # O14832
C-term
Synonyms
Phytanoyl-CoA dioxygenase, peroxisomal; Phytanic acid oxidase; PhyH; PAHX
AA Sequence

SGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL

Molecular Weight

Approximately 32 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PHYH Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PHYH Protein, Human
Cat. No.:
HY-P76544
Quantity:
MCE Japan Authorized Agent: