1. Recombinant Proteins
  2. Others
  3. Profilin-2 Protein, Human

Profilin-2 Protein, Human

Cat. No.: HY-P71237
Handling Instructions

Profilin-2 protein is a key player in protein folding. It specifically binds to cytosolic chaperone protein (c-CPN) and promotes the transfer of target proteins. It also interacts with nascent polypeptide chains, helping unnatural proteins fold correctly in various competing pathways. Profilin-2 Protein, Human is the recombinant human-derived Profilin-2 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Profilin-2 protein is a key player in protein folding. It specifically binds to cytosolic chaperone protein (c-CPN) and promotes the transfer of target proteins. It also interacts with nascent polypeptide chains, helping unnatural proteins fold correctly in various competing pathways. Profilin-2 Protein, Human is the recombinant human-derived Profilin-2 protein, expressed by E. coli , with tag free.

Background

PFDN2, a key player in protein folding, exhibits a specific binding affinity for cytosolic chaperonin (c-CPN), facilitating the transfer of target proteins to this complex. Additionally, PFDN2 interacts with nascent polypeptide chains, promoting their proper folding in an environment where various competing pathways for nonnative proteins exist. The heterohexameric structure of PFDN2 comprises two PFD-alpha type and four PFD-beta type subunits. Moreover, PFDN2 is an integral component of the PAQosome complex, collaborating with other members such as RUVBL1, RUVBL2, RPAP3, PIH1D1, PFDN6, PDRG1, UXT, URI1, ASDURF, POLR2E, and DNAAF10/WDR92 in the biogenesis of diverse protein complexes. Notably, the interaction between PFDN2 and URI1 is phosphorylation-dependent and exhibits a growth-dependent pattern, highlighting the intricate regulatory mechanisms involved in cellular processes.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P35080-1 (M1-F140)

Gene ID
Molecular Construction
N-term
Profilin-2 (M1-F140)
Accession # P35080-1
C-term
Synonyms
Profilin-II; PFN2; Profilin-2; PFL
AA Sequence

MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF

Molecular Weight

Approximately 14.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Profilin-2 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Profilin-2 Protein, Human
Cat. No.:
HY-P71237
Quantity:
MCE Japan Authorized Agent: