1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. PTH Protein, Human

PTH Protein, Human

Cat. No.: HY-P7112
COA Handling Instructions

PTH Protein, Human is a major regulator of mineral ion metabolism.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $70 In-stock
50 μg $210 In-stock
100 μg $350 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

PTH Protein, Human is a major regulator of mineral ion metabolism.

Background

Recombinant Human Parathyroid Hormone is a replica of the endogenous Parathyroid hormone molecule. Parathyroid Hormone regulates calcium and phosphorus levels by acting on the bone, kidneys and intestines. In the bone, Parathyroid hormone mobilizes calcium and phosphorus into the circulation by stimulating bone resorption. Parathyroid hormone stimulates osteoblasts to increase the expression of receptor activator of nuclear factor j-B ligand (RANKL)[1].

Biological Activity

1.PTH is fully biologically active when compared to standards. The activity calculated by UMR106 cell/cAMP method corresponding to a specifc activity of 1.0×104 U/mg.
2.Measured by its ability to induce cAMP accumulation in MC3T3‑E1 mouse preosteoblast cells. The ED50 for this effect is 26.74 ng/mL, corresponding to a specific activity is 3.739×104 U/mg.

  • Measured by its ability to induce cAMP accumulation in MC3T3‑E1 mouse preosteoblast cells. The ED50 for this effect is 26.74 ng/mL, corresponding to a specific activity is 3.739×104 U/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P01270 (S32-Q115)

Gene ID
Molecular Construction
N-term
PTH (S32-Q115)
Accession # P01270
C-term
Synonyms
rHuPTH; Parathormone; Parathyrin
AA Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

Molecular Weight

Approximately 9-15 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against 1.15 mg sodium citrate, sodium chloride 7.31 mg, 0.21 mg citric acid, 0.1117 mg EDTA-Na2, 0.2 mg Tween 80 and 50 mg Mannitol or 10 mM HAc-NaAc, 150 mM NaCl, 5% Mannitol, pH 4.0 or PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

PTH Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PTH Protein, Human
Cat. No.:
HY-P7112
Quantity:
MCE Japan Authorized Agent: